The Chlamydomonas Flagellar Proteome Project
All Transcripts Containing The Peptide LMQVNPGLQLLDLTGNEVTDK
Transcript Fraction Peptide Sequence ChlamyFPv5 Annotation Phytozome Defline
Cre09.g397993.t1.1T08LMQVNPGLQLLDLTGNEVTDK"FAP201, Leucine Rich Repeat Flagellar Associated Protein 201"1
Cre09.g397993.t1.1T08LMQVNPGLQLLDLTGNEVTDKGAAAITEVLAKPEAGLK"FAP201, Leucine Rich Repeat Flagellar Associated Protein 201"1
Cre09.g397993.t2.1T08LMQVNPGLQLLDLTGNEVTDK"FAP201, Leucine Rich Repeat Flagellar Associated Protein 201"1
Cre09.g397993.t2.1T08LMQVNPGLQLLDLTGNEVTDKGAAAITEVLAKPEAGLK"FAP201, Leucine Rich Repeat Flagellar Associated Protein 201"1