The Chlamydomonas Flagellar Proteome Project
Transcript Fraction Peptide Sequence ChlamyFPv5 Annotation Phytozome Defline
Cre16.g654150.t1.1A20KDTFLSKVPLQWSVGATGGPLQSAYTDTFGGR"FAP63, Flagellar Associated Protein 63"1