The Chlamydomonas Flagellar Proteome Project
All Transcripts Containing The Peptide GAAAITEVLAKPEAGLK
Transcript Fraction Peptide Sequence ChlamyFPv5 Annotation Phytozome Defline
Cre09.g397993.t1.1T08LMQVNPGLQLLDLTGNEVTDKGAAAITEVLAKPEAGLK"FAP201, Leucine Rich Repeat Flagellar Associated Protein 201"Similar to Flagellar Associated Protein FAP201
Cre09.g397993.t1.1A29GAAAITEVLAKPEAGLK"FAP201, Leucine Rich Repeat Flagellar Associated Protein 201"Similar to Flagellar Associated Protein FAP201
Cre09.g397993.t2.1T08LMQVNPGLQLLDLTGNEVTDKGAAAITEVLAKPEAGLK"FAP201, Leucine Rich Repeat Flagellar Associated Protein 201"Similar to Flagellar Associated Protein FAP201
Cre09.g397993.t2.1A29GAAAITEVLAKPEAGLK"FAP201, Leucine Rich Repeat Flagellar Associated Protein 201"Similar to Flagellar Associated Protein FAP201