The Chlamydomonas Flagellar Proteome Project
All Transcripts Containing The Peptide AVVWRDDSDYTSLLTPGSPLYLIDPAKPACPAK
Transcript Fraction Peptide Sequence ChlamyFPv5 Annotation Phytozome Defline
Cre02.g102050.t1.1C22AVVWRDDSDYTSLLTPGSPLYLIDPAKPACPAK"FAP328, Flagellar Associated Protein 328"