The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP227 | "FAP227, Flagellar Associated Protein 227; C1a-18, C1a projection on central pair; Similar to Testis Specific Gene A2"
Aliases: FAP227; C1a-18; PF6-IP4
Structure: Central Pair
References: "C1a-18, C1a projection on central pair (Wargo et al. Smith 2005)"
CrFP Total Peptides = 7 (2 Axonemal Peptides | 0 M+M Peptides | 1 KCl Peptides | 4 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 3 (enriched 0.89 fold by ciliary shortening)
Phytozome (gene name | defline): C1A-18 | (1 of 5) 2.7.1.68 - 1-phosphatidylinositol-4-phosphate 5-kinase / Type I PIP kinase
O. Vallon Gene Name | Defline: FAP227 | Flagellar central pair-Associated Protein 227
O. Vallon Description: Similar to Testis Specific Gene A2; Together with PF6, C1a-86, C1a-34, C1a-32 and calmodulin, forms the central pair projection C1a; may play a role in modulating both inner and outer dynein arm activity; Similar to Sjoegren syndrome nuclear autoantigen
O. Vallon Synonyms: FAP227#g17638.t1#Cre17.g729850.t1.1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: MORN2, NP_001138922.1, MORN repeat-containing protein 2 [Homo sapiens] [Cr]-central appartatus associated protein C1a-18 (Blast E value: 9.00E-13 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: MORN2, MORN repeat-containing protein 2
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 4.54; at 10 min: 7.73; at 30 min: 9.51; at 60 min: 3.53
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre17.g729850
Phytozome Transcript: Cre17.g729850.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T17FYYPSGAIYEGQWK
T17RYEGQWEENR
T17VVEEPPPEQTPPLELEGTGKFYYPSGAIYEGQWK
T17GTYAWPDGR
C37VVEEPPPEQTPPLELEGTGK
A37GHKWEGQFFNGSGPGLTCQL
A37LLNPPLPPPVEDPKDK