The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP172 | "FAP172 (CCDC40), Flagellar Associated Protein 172; possible DRC; part of 96-nm molecular ruler"
Aliases: FAP172; CCDC40; PF7
Structure:
References: "CCDC40, part of 96-nm molecular ruler (Oda et al. 2014); possible DRC (Lin et al. Nicastro 2011); methylated (Werner-Peterson and Sloboda 2013); encoded by PF7 (Lin et al. Dutcher 2015)"
CrFP Total Peptides = 23 (10 Axonemal Peptides | 0 M+M Peptides | 1 KCl Peptides | 12 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 19 (enriched 1.35 fold by ciliary shortening)
Phytozome (gene name | defline): FAP172 |
O. Vallon Gene Name | Defline: FAP172 | Flagellar Associated Protein 172
O. Vallon Description: Flagellar Associated Protein, found in the flagellar proteome; possible DRC component; part of 96-nm molecular ruler
O. Vallon Synonyms: g16937.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: CCDC40, NP_060420.2, coiled-coil domain-containing protein 40 isoform 1 [Homo sapiens] (Blast E value: 7.00E-19 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: CCDC40, hCG28571, isoform CRA_b
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 5.3; at 10 min: 13.38; at 30 min: 13.24; at 60 min: 2.7
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 254.45 FPKM | XAP Mutant: 69.38 FPKM | Fold Change: -1.87
CLIP Library: Cre17.g698365
Phytozome Transcript: Cre17.g698365.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T32TAADTQELR
T32RLEQQLEGQGK
T32QALAEDNFNLEGR
T32ALQGEADAVDR
T32AMEEEAAR
T32AIEEEMLSALSDQTTAEKATSK
T32SLEHTEAEVLR
T32LNSQIEEGR
T32GTQQQLALVSAQLEAQKR
T31DTLAEIVEAER
T31EALGVELYGFQQNLAK
T31VNGLIAANSAAR
C15GTGEETGPLEATIK
A15LQVDILNTEAHNSR
A15IRAEELAVVETENELAK
A15IRAEELAVVETENELAKLQVDILNTEAHNSR
A15LEQQLEGQGK
A15LQLNLETTHQNYQVINR
A15AAYAAEEAVQKLEK
A15KVEGDAVFVQK
A15QQLSLEEGDTKGER
A15ADPMDQPSTSDPVDNQIFGEQGGLRPDHPLLR
A15SSLLAIQK