The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP43 | "FAP43, Flagellar Associated Protein 43; part of tether complex that constrains inner arm I1/f; has region of similarity to FAP244"
Aliases: FAP43; CFAP43
Structure:
References: "Part of tether complex that constrains inner arm I1/f (Kubo et al. Oda 2018; Fu et al. Nicastro, 2018; Urbanska et al. Wloga 2018) Mutations cause loss of central pair in spermatozoa (Tang et al. Zhang 2017); Mutant mice and humans have sperm defects Coutton et al. Ray 2018)"
CrFP Total Peptides = 52 (4 Axonemal Peptides | 0 M+M Peptides | 43 KCl Peptides | 5 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 35 (enriched 1.12 fold by ciliary shortening)
Phytozome (gene name | defline): FAP43 | Flagellar Associated Protein
O. Vallon Gene Name | Defline: FAP43 | Flagellar Associated Protein 43
O. Vallon Description: Flagellar Associated Protein, found in the flagellar proteome [PMID: 15998802]; part of tether complex that constrains inner arm I1/f
O. Vallon Synonyms: Cre01.g072600.t1.2#g16875.t1#Cre01.g072600.t1.1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: CFAP43, NP_079421.5, WD repeat-containing protein 96 [Homo sapiens] (Blast E value: 4.00E-17 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: WDR96, WD repeat-containing protein 96
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 5.93; at 10 min: 12.27; at 30 min: 9.85; at 60 min: 2.25
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 772.99 FPKM | XAP Mutant: 190.15 FPKM | Fold Change: -2.02
CLIP Library: Cre16.g691440
Phytozome Transcript: Cre16.g691440.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
Cre16.g691440.t1.1--S655 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractALGSDTGDGPGGPELVTIKALGpSDTGDGPGGPELVTIK
Cre16.g691440.t1.1--T657 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractALGSDTGDGPGGPELVTIKALGSDpTGDGPGGPELVTIK
Cre16.g691440.t1.1--T657(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractALGSDTGDGPGGPELVTIK
FAP43, Conserved Uncharacterized Flagellar Associated Protein(Pazour unpublished)Purified FlagellaALGSDTGDGPGGPELVTIKALGpSDTGDGPGGPELVTIK
(Pan et al. Hippler 2011)Purified Flagella ALGSDTGDGPGGPELVTIK
(Pan et al. Hippler 2011)Purified Flagella ALGSDTGDGPGGPELVTIK
(Pan et al. Hippler 2011)Purified Flagella ALGSDTGDGPGGPELVTIK
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T27AAAGDLVLAR
T27KVAAYDNEVQLR
T27IVMLAASVGR
T27QMMGGTLAAR
T26LVLPAEAAAWAGLR
C27LQAGMQSANDQATR
C27EIALAQQNELGELR
C27LLAGSPSSSSVAGRT
C27LAADVSSR
C27LLAGQVEAMPPRPASADMSDAR
C10EAAMGGVEGAAGGESK
C10FDDSLAALAAR
C10LAGVVPHPGGGAFLTTGSDGSVR
C10DVQAGFNTDFNK
C10VWSTTDGALLGR
C10KPEQLASMPGGGAIGAAGGHQSGVEASSGSFSR
C10LHSAPVDVLVFSPANDLLLSAGR
C10EEGAGGGADKPSGSGAVSGK
C10QAQLGADER
C10EAAMGGVEGAAGGESKR
C10DNIAATVLMVREEEVGAER
C10YGDAYGLGADK
C10AAVEELVGRFDDSLAALAAR
C10VHNFPLTQPGQHER
C09VFVSVPAAAAAITPEPLALSHEVWLGR
C08ALGSDTGDGPGGPELVTIK
C08SSALEAANLEALMK
C08AEGGDDFDDPAELTVVAAAR
C08SAQNQEVAVHLVTLGK
C08AAAEVCALESR
C08LGAGPPAGLLDER
C08VAAVQAAVKK
C08FSLSAQQDTR
C08DMQTVLKDGEDR
C08HGLLAIAEK
C08MRDVQAGFNTDFNK
C08KLAADVSSR
C08DLQLLHVTR
C08GLKPMVTVYSTK
C08DLVAVAGADGSVR
C08VPGGAPGLHR
C08VLEEQQR
C08ARKPEQLASMPGGGAIGAAGGHQSGVEASSGSFSR
C07EFAEADIHLNR
C07IADLLAANEAAPELER
C07VAAVQAAVK
C07NPYPDMVLVRPLGGAGGGGAGGGASR
C07LITEEQNR
A07GVVESLNSVVLGK
A07AALAELESR
A07ASGGVAVAPGGHLLASGAADGTVALR
A07AASELSER