The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP73 | "FAP73, Flagellar Associated Protein 73; MIA2 subunit of the modifier of inner arms (MIA) complex"
Aliases: FAP73; MIA2; CFAP73
Structure:
References: "Encodes the MIA2 subunit of the modifier of inner arms (MIA) complex (Yamamoto et al. Sale 2013); Localized to spot between basal bodies (Lechtreck et al. Witman 2009)"
CrFP Total Peptides = 18 (0 Axonemal Peptides | 0 M+M Peptides | 13 KCl Peptides | 5 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = (enriched fold by ciliary shortening)
Phytozome (gene name | defline): FAP73 | Flagellar Associated Protein
O. Vallon Gene Name | Defline: FAP73 | Flagellar Associated Protein 73
O. Vallon Description: Conserved uncharacterized Flagellar Associated Protein; found in the flagellar proteome [PMID: 15998802]; MIA2 subunit of the modifier of inner arms (MIA) complex
O. Vallon Synonyms: Cre16.g689600.t1.1#g16187.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: CFAP73, NP_001138344.1, coiled-coil domain-containing protein 42B [Homo sapiens] (Blast E value: 8.00E-34 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: CCDC42, coiled-coil domain-containing protein 42A isoform 1
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 6.76; at 10 min: 12.02; at 30 min: 4.74; at 60 min: 1.89
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 819.85 FPKM | XAP Mutant: 127.14 FPKM | Fold Change: -2.69
CLIP Library: Cre16.g689600
Phytozome Transcript: Cre16.g689600.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T11KDSSLQIASQR
T11LKDLELQESLIR
T11SSIGHPAESNPLHQLDVIGNFVSDLGSIIK
T11FLQENDSKR
T10MMPQTLVLDHVSPATR
C31TLEYGQVVLSADNIFNR
C31DSSLQIASQR
C29LKTELEGYEAEAMVQEAK
C29QKTDEILNLNNQVAK
C29TDEILNLNNQVAK
C29HATLSATNADLKDHQR
C29ASLASRAEIE
C29MDEEGSATAR
C29AKMMPQTLVLDHVSPATR
C29LKTELEGYEAEAMVQEAKK
C29ILEVLEK
C29HATLSATNADLK
C29FLQENDSK