The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP295 | "FAP295, Flagellar Associated Protein 295; Similar to cyclic nucleotide dependent protein kinase"
Aliases: FAP295
Structure:
References: "cGMP-dependent protein kinase? HA-tagged (Lechtreck et al. Witman 2009)"
CrFP Total Peptides = 26 (4 Axonemal Peptides | 7 M+M Peptides | 14 KCl Peptides | 1 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 15 (enriched 1.33 fold by ciliary shortening)
Phytozome (gene name | defline): FAP295 | "Flagellar Associated Protein, cyclic nucleotide dependent protein kinase"
O. Vallon Gene Name | Defline: FAP295 | Flagellar Associated Protein 295
O. Vallon Description: Flagellar Associated Protein, found in the flagellar proteome; Similar to cyclic nucleotide dependent protein kinase
O. Vallon Synonyms: g16011.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: PRKG2, CAA76073.1, cGMP-dependant protein kinase [Homo sapiens] (Blast E value: 6.00E-100 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: ; at 10 min: ; at 30 min: ; at 60 min:
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre16.g663200
Phytozome Transcript: Cre16.g663200.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
(Pan et al. Hippler 2011)Purified Flagella LEGMDPGASGKEANTLVLTEGTVLGGGAFSR
(Pan et al. Hippler 2011)Purified Flagella LEGMDPGASGKEANTLVLTEGTVLGGGAFSR
(Pan et al. Hippler 2011)Purified Flagella LEGMDPGASGKEANTLVLTEGTVLGGGAFSR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T08VSIVTEESTGR
C30LLLFGKLDSQVQR
C30EKSNQVVAQK
C30SNQVVAQK
C30LDSQVQR
C27WFENLAWEELEAR
C27TDDPMVVMR
C27LEGMDPGASGK
C27MLQGMSEDLAR
C19VIVEGDKGDLFYIVK
C19ALLKDEPR
C19GHLDEVLELR
C19VIVEGDKGDLFYIVKEGEAIVYQNTPGGQR
C19TVPAGDILIKEGDTGLAACELYVVK
C19ETFQEILGPLEQLMAR
B27EGDTGLAACELYVVK
B27EGEAIVYQNTPGGQR
B27SQPEDYAFIENALGR
B27MATVEAYTK
B27SGKFEVLQK
B27IVSEMYER
B24LGDFGFAK
A19LVDAFEENTYQAGQK
A19TATVAATMDAVVWALDR
A19DLKPENVFIDASGYVK
A19IVDENYQIKYPPYLSPAAK