The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP63 | "FAP63, Flagellar Associated Protein 63"
Aliases: FAP63
Structure:
References:
CrFP Total Peptides = 19 (17 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 2 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 11 (enriched 1.29 fold by ciliary shortening)
Phytozome (gene name | defline): FAP63 | Flagellar Associated Protein
O. Vallon Gene Name | Defline: FAP63 | Flagellar Associated Protein 63
O. Vallon Description: Flagellar Associated Protein; found in the flagellar proteome [PMID: 15998802]; in basal body proteome as BUG20 [PMID: 15964273]. Transcript upregulated during flagellar regeneration [PMID: 15738400]
O. Vallon Synonyms: g15816.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: CRX, ABC69290.1, CRX like homeobox 1 [Homo sapiens] (Blast E value: 3.00E-05 | Reprocal Best Match? No)
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 23.21; at 10 min: 19.51; at 30 min: 5.49; at 60 min: 1.31
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 648.78 FPKM | XAP Mutant: 167.39 FPKM | Fold Change: -1.95
CLIP Library: Cre16.g654150
Phytozome Transcript: Cre16.g654150.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
FAP63, Flagellar Associated Protein(Pazour unpublished)Purified FlagellaARPNSALLRARPNpSALLR
(Pan et al. Hippler 2011)Purified Flagella PATAELRPNTVELSFGASMPAGAGAEPSSGALR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T04TAYPVPESFLGATISGGTGSIPFPQR
T04RAFATAGQEK
A20GTGGANVPAPR
A20SMYPEIYDQALR
A20KDTFLSKVPLQWSVGATGGPLQSAYTDTFGGR
A20RPPLAPGGATVVAQGWSYTATR
A20GQDLESVLAGADDDQKR
A20QLHAAVDPDQIK
A20VMFNGPTASAGK
A20QKTYYGDLLAR
A20DLFSKEVEGWLGR
A20RAFATAGQEKK
A20KDLFSKEVEGWLGR
A20GIQNLELEAK
A20QSPDAHADFVNSTLDK
A20AFATAGQEK
A20DTFLSK
A20AALSRPETQSTLASLTDR
A19VAEEQAAAAAAAER