The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): MST1 | "MST1, Mastigoneme"
Aliases: MST1
Structure: Membrane
References: (Song and Dentler Genbank)(Bloodgood 2009, Chlamydomonas Sourcebook Chapter 11); not conserved in humans except for two small tumor necrosis factor receptor superfamily motifs
CrFP Total Peptides = 29 (7 Axonemal Peptides | 5 M+M Peptides | 10 KCl Peptides | 7 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 30 (enriched 0.84 fold by ciliary shortening)
Phytozome (gene name | defline): | Mastigoneme-like flagellar protein
O. Vallon Gene Name | Defline: MST1 | Mastigoneme-like flagellar protein
O. Vallon Description: Mastigoneme-like protein; 240 kDa flagellar protein in Chlamydomonas; Genbank entry AF508983. Mastigonemes are protein projections from the flagellar membrane. Found in the flagellar proteome [PMID: 15998802]
O. Vallon Synonyms: MST1#Cre16.g650600.t1.1#g15740.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: none, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 1.15; at 10 min: 2.43; at 30 min: 3.19; at 60 min: 2.98
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 2457.78 FPKM | XAP Mutant: 802.13 FPKM | Fold Change: -1.62
CLIP Library: Cre16.g650600
Phytozome Transcript: Cre16.g650600.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T27VAVDAYPYPVGQCR
T26TGSSQCTPCAAGFYANAPDSATSCR
T26YGGELCTK
T25CPGGTATMDGYR
T25VSCTFPTLYAAAGPFSPK
T25QCTACPPLDLGGGNLVEQCTEDLGSQR
T25CPYDFFADRPGVR
C06TALTMTNVGAAAPNAIASLSNQYTSGGTK
C06TYAAAAASLQGK
C06HLSSTSQVWWTIDYGAGESSPR
C06IVVITVSNAGYTLALAK
C06AYTISGMVAGPAYAKPIVTGPDTNFFMAGK
C06LNLAFSGFK
C02LYDSAVAPGVLLASK
C02TTTGALSTTPTANLVSAGTYTVTYASIGTK
C02IFIGIAPTASTNYDFVIPDQVYNLEGAK
C01TGAAPTTDAGWAALAGSANGK
B05VVTMAPGTGR
B05GCYKCPYDFFADRPGVR
B04TTADPVTTDDTIAFSAGAK
B04TFTDVTTAVATDANYFADQQLR
B03YQNSIGQR
A08IYDAPVGGTLLR
A07GYYGPYSGAYADNLGDEFEGPR
A07VSTPVTYTFTITR
A07NAAVTASAK
A06GQAAIASMNLAAVSSATPCRPCEDGTWSK
A06CPAGTVASK
A02LYDGANNVIAEK