The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP312 | "FAP312, Flagellar Associated Protein 312"
Aliases: FAP312
CrFP Total Peptides = 6 (0 Axonemal Peptides | 0 M+M Peptides | 6 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 8 (enriched 1 fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 8 | Dhc1b-3 M+M: 9 | Ift139-2 M+M: 10 (Total Unique Peptides)
Phytozome (gene name | defline): |
Annotation v5.6 Symbol | Defline: FAP312 | Flagellar Associated Protein 312
Annotation v5.6 Description: NULL
Annotation v5.6 Synonyms: g15177.t2#Cre14.g630200.t1.1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: none, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 3.95; at 10 min: 9.07; at 30 min: 4.96; at 60 min: 2.14
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 129.10 FPKM | XAP Mutant: 40.21 FPKM | Fold Change: -1.68
CLIP Library: Cre14.g630200
Phytozome Transcript: Cre14.g630200.t2.1
Protein Reference Source Peptide pLOGO
Cre14.g630200.t2.1--S615(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractAPLPTLAPPLSPSK
Cre14.g630200.t2.1--S159(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractSAGSGALDGEAGGEAGGGGGK
(Pan et al. Hippler 2011)Purified Flagella ARPQSSMGKPNTPDVNISLTGANDWGAPGNGR
(Pan et al. Hippler 2011)Purified Flagella GVSVSGAAASAGGGVGSAAAAVAAAR
(Pan et al. Hippler 2011)Purified Flagella GVSVSGAAASAGGGVGSAAAAVAAAR
(Pan et al. Hippler 2011)Purified Flagella GVSVSGAAASAGGGVGSAAAAVAAAR
(Pan et al. Hippler 2011)Purified Flagella RLTAEQEQLEEQLR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
© Gregory J. Pazour