The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP312 | "FAP312, Flagellar Associated Protein 312"
Aliases: FAP312
Structure:
References:
CrFP Total Peptides = 6 (0 Axonemal Peptides | 0 M+M Peptides | 6 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 8 (enriched 1.24 fold by ciliary shortening)
Phytozome (gene name | defline): |
Annotation v5.6 Symbol | Defline: FAP312 | Flagellar Associated Protein 312
Annotation v5.6 Description: NULL
Annotation v5.6 Synonyms: g15177.t2#Cre14.g630200.t1.1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: none, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 3.95; at 10 min: 9.07; at 30 min: 4.96; at 60 min: 2.14
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 129.10 FPKM | XAP Mutant: 40.21 FPKM | Fold Change: -1.68
CLIP Library: Cre14.g630200
Phytozome Transcript: Cre14.g630200.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
(Pan et al. Hippler 2011)Purified Flagella ARPQSSMGKPNTPDVNISLTGANDWGAPGNGR
(Pan et al. Hippler 2011)Purified Flagella GVSVSGAAASAGGGVGSAAAAVAAAR
(Pan et al. Hippler 2011)Purified Flagella GVSVSGAAASAGGGVGSAAAAVAAAR
(Pan et al. Hippler 2011)Purified Flagella GVSVSGAAASAGGGVGSAAAAVAAAR
(Pan et al. Hippler 2011)Purified Flagella RLTAEQEQLEEQLR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
C44SGTGTGDILAGSLR
C44TQPSALDTLMPAGGVTLR
C41VAGPSGDLGDANR
C40APLPTLAPPLSPSK
C40NTDRLQFTSVLAE
C36SAGSGALDGEAGGEAGGGGGK
© Gregory J. Pazour