The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP33 | "FAP33, Flagellar Associated Protein 33"
Aliases: FAP33; ANK17
Structure:
References:
CrFP Total Peptides = 74 (2 Axonemal Peptides | 27 M+M Peptides | 42 KCl Peptides | 3 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 50 (enriched 1.4 fold by ciliary shortening)
Phytozome (gene name | defline): FAP33 | Flagellar Associated Protein with ankyrin repeats
O. Vallon Gene Name | Defline: FAP33 | Flagellar Associated Protein 33
O. Vallon Description: Protein of unknown function with ankyrin repeats, flagella associated; found in the flagellar proteome as FAP33. Phosphorylation characterized by Boesger et al. (29) [PMID: 19429781]
O. Vallon Synonyms: ANK17#g14814.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: ANK2, NP_001120965.1, ankyrin-2 isoform 3 [Homo sapiens] ANK17 in JGI vs.4 (Blast E value: 1.00E-24 | Reprocal Best Match? No)
Albee et al. Dutcher 2013 Human Homolog: ANK2, ankyrin 2, neuronal, isoform CRA_a
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 0.95; at 10 min: 6.67; at 30 min: 7.98; at 60 min: 3.6
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre14.g614850
Phytozome Transcript: Cre14.g614850.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
Cre14.g614850.t1.1--S740 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractMDGAAAAAAAGSDPDLGKMDGAAAAAAAGpSDPDLGK
Cre14.g614850.t1.1--S1065 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractSSLSGSPAAAAAATARSpSLSGSPAAAAAATAR
Cre14.g614850.t1.1--S1007 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractSGSFNGAVPAAASPVAAAAGGGAASIIQRSGpSFNGAVPAAASPVAAAAGGGAASIIQR
Cre14.g614850.t1.1--S1069 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractRSSLSGSPAAAAAATARRSSLSGpSPAAAAAATAR
Cre14.g614850.t1.1--S812(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractGGAYGDAGGDAAEAVESFSLPGGANGASR
Cre14.g614850.t1.1--S740(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractMDGAAAAAAAGSDPDLGK
Cre14.g614850.t1.1--S1007(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractSGSFNGAVPAAASPVAAAAGGGAASIIQR
(Pan et al. Hippler 2011)Purified Flagella AHRISGGGDGALAASGFADATVK
(Pan et al. Hippler 2011)Purified Flagella GGAYGDAGGDAAEAVESFSLPGGANGASR
(Pan et al. Hippler 2011)Purified Flagella GGPAEDYLDVVPEALEAEEEADDGAWDLGSGR
(Pan et al. Hippler 2011)Purified Flagella ISGGGDGALAASGFADATVK
(Pan et al. Hippler 2011)Purified Flagella MDGAAAAAAAGSDPDLGK
(Pan et al. Hippler 2011)Purified Flagella RGGPAEDYLDVVPEALEAEEEADDGAWDLGSGR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T33GGAYGDAGGDAAEAVESFSLPGGANGASR
T33VAITDPYYK
T06KSENPEEEGHTALHFAAAR
C23VGAVPLAELLALADAGLAER
C23SNFSATNAGAK
C19GHADVSQTLLEKAEDK
C19GAGGATPLHTALEAGKR
C19CGSDLSHGATDK
C19NALHYAAAK
C19SENPEEEGHTALHFAAAR
C18YGSAEFIR
C18LSTWLLQR
C17EVVVETPLLMAVASHQDR
C17GPLHLAALHDNAFMVK
C17GHKEMAALLMAEGGPGMAAHVTDAAGNTPLHLAALR
C17GHADVSQTLLEKAEDKSAAILTANR
C17GVLWILDHISADDAR
C17AGGASSLDWSAHSDGLGR
C17EGVSVYHLMLQAGPEDR
C17GHADVSQTLLEK
C17AGLTAAAAVAR
C17ISGGGDGALAASGFADATVK
C17QIAHFLLEHGADINATDK
C17VVAALLEAGHQPNQAADTGGDIPLSR
C17LPAAAGGGAGGR
C17LLEAGASPMVPAFK
C17SAAILTANR
C17EMAALLMAEGGPGMAAHVTDAAGNTPLHLAALR
C16RSALEASAAALAGGVALDEAGVMDAKPLK
C16YPAPAEEAAPPAAADLR
C16MESALEDLKDAGMGLVSK
C16YAVNFLMEMR
C16EVRPALEDLPGMSAEAAKK
C16YTPLQEAMMYAR
C16EVRPALEDLPGMSAEAAK
C16SALEASAAALAGGVALDEAGVMDAKPLK
C16LPQVNYTR
C16AFMLPATLAPSAAGDGVAVAAEAQAAAAAELR
C16IEIPGLTKPHGFVTPLHLAAR
C16CDEAYFGSGGK
C16WYNHSLSPQEYPMK
C16DDIESLKSDPDIGYPAIR
C16DKHNTTLQHVYDMLLAK
C16LLDIQQK
C16DADQKANAMLR
B16CLASATADTAAADAAIFK
B15LAAAAGGEAPTALNTR
B15FSEQVVELLAAK
B15DGDAGEVER
B15YGGNVCLLATTADAADDLPEKLPAAAGGGAGGR
B14SGASPFLAVLVSGR
B14NGWWDFLEK
B13YGAAGLLSGDVLTGVVNK
B13AAAQADADGGDIGGGATIK
B13WAKDGDAGEVER
B13GALSNGGGSVPYAK
B13SAEGDTPLGWALK
B13QIQSGAK
B13IDVEAVSK
B13KQIQSGAK
B12APYELADTQTGILLR
B12EAAAAAAEHESWGR
B12LAKEWAEEQER
B12AFVDPTMMALK
B12TGQAEVVFLLLRR
B12SDPDIGYPAIR
B11TGQAEVVFLLLR
B11ASLGLMQK
B11YPAPAEEAAPPAAADLRER
B11DAGMGLVSK
B11RVAITDPYYK
B11LARYPAPAEEAAPPAAADLRER
A17DQDPADLR
A16ETSALVYAVR