The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP161 | "FAP161, Flagellar Associated Protein 161"
Aliases: FAP161; CFAP161
Structure:
References:
CrFP Total Peptides = 6 (4 Axonemal Peptides | 0 M+M Peptides | 2 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 7 (enriched 1 fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 3 | Dhc1b-3 M+M: 6 | Ift139-2 M+M: 6 (Total Unique Peptides)
Phytozome (gene name | defline): FAP161 | Flagellar Associated Protein
Annotation v5.6 Symbol | Defline: FAP161 | Flagellar Associated Protein 161
Annotation v5.6 Description: Flagellar Associated Protein, found in the flagellar proteome
Annotation v5.6 Synonyms: g13885.t1#Cre13.g564400.t1.1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: CFAP161, NP_775799.2, uncharacterized protein C15orf26 [Homo sapiens] (Blast E value: 0 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: C15orf26, uncharacterized protein C15orf26
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 2.37; at 10 min: 3.67; at 30 min: 4.75; at 60 min: 2.09
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 426.66 FPKM | XAP Mutant: 204.73 FPKM | Fold Change: -1.06
CLIP Library: Cre13.g564400
Phytozome Transcript: Cre13.g564400.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
C26VADDPYIHFGDVVQLVHVDTGCVLAGDPADADTR
C26TGESTCAATAAPDVR
A28QVGSQLPEDGIAALLTR
A28LAMEQMAMGVQK
A28KLVTLENNQSLMSAEDFK
A27YAPAGSRPGTR
© Gregory J. Pazour