The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP67 | "FAP67, Flagellar Associated Protein 67; Similar to Nucleoside Diphosphate Kinase. Mouse mutation has situs inversus and hydrocephaly"
Aliases: FAP67; CFAP67
Structure:
References:
CrFP Total Peptides = 20 (7 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 13 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 6 (enriched 1.36 fold by ciliary shortening)
Phytozome (gene name | defline): FAP67 | "Flagellar Associated Protein, nucleoside diphosphate kinase-like"
O. Vallon Gene Name | Defline: FAP67 | Flagellar Associated Protein 67
O. Vallon Description: Found in the flagellar proteome [PMID: 15998802]; in basal body proteome as BUG5 [PMID: 15964273]. Transcript upregulated during flagellar regeneration [PMID: 15738400]; Similar to Nucleoside Diphosphate Kinase. Mouse mutation has situs inversus and hydro
O. Vallon Synonyms: Cre12.g558700.t1.1#g13354.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: NME7, NP_037462.1, nucleoside diphosphate kinase 7 isoform a [Homo sapiens]; knockout mouse available hydrocephalus and excessive nasal exudates and situs inversus (Blast E value: 2.00E-113 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: NME7, nucleoside diphosphate kinase 7 isoform a
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 4.61; at 10 min: 8.54; at 30 min: 10.36; at 60 min: 3.71
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 371.03 FPKM | XAP Mutant: 181.98 FPKM | Fold Change: -1.03
CLIP Library: Cre12.g558700
Phytozome Transcript: Cre12.g558700.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T10IINAICQSGFLISK
T10TKYEELKPSLLFLGSVVTVFSR
T10LTEYGDEFTR
T10WRELIGPTDSNQAR
T10TLAMIKPDAYK
T10VVAMELVAPGAIRK
T10VVAMELVAPGAIR
T10QLKLTEYGDEFTR
T09ELIGPTDSNQAR
T09EVEMVDIK
T09YQLFYYPESK
T09TFNACHGSDAPDTAAEECNFWFGPGRYPGK
T09LSKEEAGEFYAVHAGKPFVDR
A30LTDFMSSGR
A30DGADAVEPFR
A30NAAAEFLEVYK
A30EEAGEFYAVHAGKPFVDR
A30NRMESQSER
A30AEAPGSLR
A29QLAGPLDPELGR