The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP125 | "FAP125, Flagellar Associated Protein 125; Similar to Kinesin KIF17"
Aliases: FAP125; KIN14-2
Structure:
References:
CrFP Total Peptides = 13 (7 Axonemal Peptides | 0 M+M Peptides | 2 KCl Peptides | 4 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 19 (enriched 1 fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 7 | Dhc1b-3 M+M: 7 | Ift139-2 M+M: 8 (Total Unique Peptides)
Phytozome (gene name | defline): FAP125 | "Kinesin-like motor protein, kinesin-14 (C-terminal motor) family"
Annotation v5.6 Symbol | Defline: FAP125 | Flagellar Associated Protein 125
Annotation v5.6 Description: kinesin-14 (C-terminal motor) family; Similar to Kinesin KIF17; Flagellar Associated Protein found in the flagellar proteome
Annotation v5.6 Synonyms: KIN14-2#g13633.t2
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: KIF3B, NP_004789.1, kinesin-like protein KIF3B [Homo sapiens] (Blast E value: 0 | Reprocal Best Match? No)
Albee et al. Dutcher 2013 Human Homolog: KIF3B, kinesin-like protein KIF3B
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 5.86; at 10 min: 18.35; at 30 min: 3.99; at 60 min: 3.00
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 576.39 FPKM | XAP Mutant: 70.55 FPKM | Fold Change: -3.03
CLIP Library: Cre12.g546100
Phytozome Transcript: Cre12.g546100.t2.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
(Pan et al. Hippler 2011)Purified Flagella LAPSWGLGHAPGSPQMGLNGMSRPGTAGLVSLAGGSPK
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T32STATSLGAAADYVR
T32VSVLEAQVR
T31SVVGGSASVANSR
T31STAQQYEER
C26KAEAAAATGGGNSAPR
C23LNLVDLAGSER
A15ATSATAANDVSSR
A15SQLAQVTGSVGGLVEK
A14AEAAAATGGGNSAPR
A14NSEMAVALR
A14GEQQPVTGR
A14ATFAVEKDGLLAELDYLSSYSER
A14KLEGQLAQAR
© Gregory J. Pazour