The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP117 | "FAP117, Flagellar Associated Protein 117"
Aliases: FAP117
Structure:
References:
CrFP Total Peptides = 11 (2 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 9 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 5 (enriched 1.30 fold by ciliary shortening)
Phytozome (gene name | defline): FAP117 | Flagellar Associated Protein
Annotation v5.6 Symbol | Defline: FAP117 | Flagellar Associated Protein 117
Annotation v5.6 Description: Flagellar Associated Protein, found in the flagellar proteome
Annotation v5.6 Synonyms: Cre12.g517050.t1.1#g12752.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: HRNR, NP_001009931.1, hornerin [Homo sapiens] (Blast E value: 0.00 | Reprocal Best Match? No)
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 1.31; at 10 min: 1.97; at 30 min: 3.54; at 60 min: 2.19
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 186.25 FPKM | XAP Mutant: 39.05 FPKM | Fold Change: -2.25
CLIP Library: Cre12.g517050
Phytozome Transcript: Cre12.g517050.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
Cre12.g517050.t1.2--S72 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractAQSAPSYRAQpSAPSYR
Cre12.g517050.t1.2--S72(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractAQSAPSYR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T13SSGGWGFGSGDRFSEVK
T12YGNPGPGAYSSPR
T12GLPGNTPSALQSPGAGTYEAPSALFNQASSK
T12TDKLAGAQYEAK
T12PVEVAGTVSTFGQQSLSTKPTEPR
T12QVQSINTTEPTAR
T12ESQGAHSPSPNAYSPK
T12FQLDHEAGESR
T12FGIFKDEFATPSPGSFKPASGWIGDAPTYSFHGGSR
A33LGPGGETGGEAPR
A33GVTTNLVSGFGLQPSSR
© Gregory J. Pazour