The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): PGH1 | "Enolase (2-Phosphoglycerate Dehydratase)"
Aliases: PGH1; ENO
Structure:
References:
CrFP Total Peptides = 26 (2 Axonemal Peptides | 13 M+M Peptides | 9 KCl Peptides | 2 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 13 (enriched 1.25 fold by ciliary shortening)
Phytozome (gene name | defline): PGH1 | Enolase
O. Vallon Gene Name | Defline: PGH1 | Enolase
O. Vallon Description: Phosphoenolpyruvate hydratase; 2-phosphoglycerate dehydratase; EC 4.2.1.11 [GI:18143, Dumont et al. (1993) Plant Sci. 89, 55-67]; product localization unsure: an N-terminal extension also found in Dunaliella and At1g74030 potentially targets it to an orga
O. Vallon Synonyms: g12671.t1#Cre12.g513200.t1.1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: multiple, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: ; at 10 min: ; at 30 min: ; at 60 min:
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 5399.12 FPKM | XAP Mutant: 1273.51 FPKM | Fold Change: -2.08
CLIP Library: Cre12.g513200
Phytozome Transcript: Cre12.g513200.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T01KYPVISIEDPFEQDDWEPCAK
T01MKDLDGTDNKGK
C24SVQEYIEKHGLEK
C24YGQDACNVGDEGGFAPNIGSNDEGLNLVNEAIEK
C24HIADLAGNSK
C24YNQLLRIEEELGENAVYAGESWR
C24AKYGQDACNVGDEGGFAPNIGSNDEGLNLVNEAIEK
C24YNQLLR
C24SVQEYIEK
C23AAVPSGASTGVHEAVELR
C23AVENINAIIAPALK
B23GNPTVEADVYTR
B22AVNALLLK
B21LTTENICQVVGDDILVTNPVRVK
B21GMDPVKQAEIDQK
B21SGETEDSFIADLAVGLASGQIK
B21QIIDSRGNPTVEADVYTR
B21GNPTVEADVYTRK
B21EAGWGVMTSHR
B21ALGQLTPPEIVKVVGR
B21AVENINAIIAPALKGMDPVK
B21QAEIDQK
B21DLDGTDNKGK
B21AGYTGKVK
A25VNQIGTITESIEAVR
A25ALGQLTPPEIVK