The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP52 | "FAP52, Flagellar Associated Protein 52"
Aliases: FAP52; CFAP52
Structure:
References: "WD repeat axonemal protein; HA-tagged by (Lechtreck et al. Witman 2009)"
CrFP Total Peptides = 26 (19 Axonemal Peptides | 0 M+M Peptides | 1 KCl Peptides | 6 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 16 (enriched 1.15 fold by ciliary shortening)
Phytozome (gene name | defline): FAP52 | Flagellar Associated Protein
O. Vallon Gene Name | Defline: FAP52 | Flagellar Associated Protein 52
O. Vallon Description: Conserved uncharacterized Flagellar Associated Protein; found in the flagellar proteome [PMID: 15998802]; in basal body proteome as BUG14 [PMID: 15964273]. Transcript upregulated during flagellar regeneration [PMID: 15738400
O. Vallon Synonyms: Cre12.g489750.t1.1#g12190.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: CFAP52, NP_659491.4, WD repeat-containing protein 16 isoform b [Homo sapiens] (Blast E value: 0.00E+00 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: WDR16, WD repeat domain 16, isoform CRA_c
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 7.07; at 10 min: 13.23; at 30 min: 12.79; at 60 min: 2.97
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 1053.03 FPKM | XAP Mutant: 96.22 FPKM | Fold Change: -3.45
CLIP Library: Cre12.g489750
Phytozome Transcript: Cre12.g489750.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T05KVTYWDAYDGNAIR
T04SVVVDANDEYAYCGTTTGDVLQIALER
T04LWGYDEGHCYFVGVAHSGAITAVGVTPDKQR
T04ILSGGEEGMVR
T04LRPTDATLGTLKR
T04AVTAIASTADSSR
C21SVVYHPDESQLVTAGTDR
A41TIIYPLGSTIVLR
A24IIDGSDLDEVNALAVDR
A24IIDGSDLDEVNALAVDRDGEALVSGGGDK
A23SQEFLQGHSDKVSCLALSR
A23KMPALAGTKVEGAITSIALADMNAR
A23TSQTLEASMK
A23MPALAGTK
A22AEPLVLNSVIGFGGAIENGLIAHPDGR
A22VEGAITSIALADMNAR
A22IIFTINDAHQK
A22LKEELVQTAHNDK
A22GFTFFVGTAMCNIYK
A22LRPTDATLGTLK
A22DGEALVSGGGDKLVK
A22IVSVGTEGGIFIWDYQRPQTLADI
A22SVVYHPDESQLVTAGTDRK
A22VTYEPATSR
A22TVPEPSSTNPK
A21VTYWDAYDGNAIR