The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): DRC4 | "DRC4 (PF2), Dynein Regulatory Complex Protein 4"
Aliases: DRC4; PF2; GAS8
Structure: Dynein Regulatory Complex
References: (Rupp and Porter 2003)
CrFP Total Peptides = 17 (13 Axonemal Peptides | 0 M+M Peptides | 2 KCl Peptides | 2 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 5 (enriched 1.3 fold by ciliary shortening)
Phytozome (gene name | defline): DRC4 | Component of dynein regulatory complex
O. Vallon Gene Name | Defline: DRC4 | Dynein Regulatory Complex Protein 4
O. Vallon Description: Component (DRC4) of dynein regulatory complex (DRC) of flagellar axoneme, originally identified by pf2 mutation; has similarity to mammalian growth-arrest specific gene product (Gas11/Gas8); component of dynein regulatory complex (DRC) of flagellar axonem
O. Vallon Synonyms: Cre11.g476850.t1.1#g11843.t1#PF2
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: GAS8, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: GAS8, growth arrest-specific protein 8
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 8.08; at 10 min: 16.55; at 30 min: 10.4; at 60 min: 2.44
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre11.g476850
Phytozome Transcript: Cre11.g476850.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T07LRQEFEQQAK
T07KNTHINELMK
C23NLEWENEVLSQR
C23KQEIHEIEER
A25KVEALGEALEMK
A25EQELAHQDIIR
A25KDAVATGDIEGASVEELNQK
A25KVEALGEALEMKEAQLAEVLTAANLDPGTLAAINQR
A25LSLAQTK
A24NYYNDITHNNLDLIK
A24LEEVLDNKNQIIK
A24NLKLELKEQELAHQDIIR
A24VQTERDELYGKFEASIYDVQQK
A24TLKEDVAEMK
A24LELKEQELAHQDIIR
A24LQQDEYR
A24AFAEIKNYYNDITHNNLDLIK