The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): IFT54 | "IFT54 (FAP116 | Dyf-11 | Elipsa), Intraflagellar Transport Protein 54"
Aliases: IFT54; FAP116; Dyf-11; Elipsa; Traf3ip1
Structure: Intraflagellar Transport
References: (Follit et al. Pazour 2009); Ciliary level increases during disassembly (Wang et al. Pan 2017)
CrFP Total Peptides = 11 (0 Axonemal Peptides | 11 M+M Peptides | 0 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 2 (enriched 2.44 fold by ciliary shortening)
Phytozome (gene name | defline): | Intraflagellar transport protein 54
O. Vallon Gene Name | Defline: IFT54 | Intraflagellar Transport Protein 54
O. Vallon Description: belongs to peripheral subcomplex of IFT-B particle; similar to human TRAF3IP1
O. Vallon Synonyms: g11669.t1#Cre22.g764600.t1.1#Cre22.g764600.t1.2
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: TRAF3IP1, NP_001132962.1, IFT54 TRAF3-interacting protein 1 isoform 2 [Homo sapiens] (Blast E value: 4.00E-29 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: TRAF3IP1, TRAF3IP1 protein
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 3.38; at 10 min: 6.4; at 30 min: 6.91; at 60 min: 2.15
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre11.g467739
Phytozome Transcript: Cre11.g467739.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
Cre11.g467739.t1.1--S243 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractSASPGGEDPLNKSApSPGGEDPLNK
Cre11.g467739.t1.1--S243(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractSASPGGEDPLNK
Cre11.g467739.t1.1--T332(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractVTKPVAVFTDNAKDNSDDEVEVVHEQTPVLSGGANMTGEQGVLVK
(Pan et al. Hippler 2011)Purified Flagella DNSDDEVEVVHEQTPVLSGGANMTGEQGVLVK
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
B39LLAMATAGR
B37LQGEAANVDAQLADLDGQIK
B37AAGAGAAAAGPR
B37MYQDELAR
B37AGVDATADNADTSDQGSTGIILKR
B37AGVDATADNADTSDQGSTGIILK
B36LQGEAANVDAQLADLDGQIKQAR
B35VLGGGGAEPAPAK
B34CDNWQATIDTLQGASPVFDKPK
B30DILAAEK
B30GQILRNDETLGK