The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): IFT54 | "IFT54 (FAP116 | Dyf-11 | Elipsa), Intraflagellar Transport Protein 54"
Aliases: IFT54; FAP116; Dyf-11; Elipsa; Traf3ip1
Structure: Intraflagellar Transport
References: (Follit et al. Pazour 2009); Ciliary level increases during disassembly (Wang et al. Pan 2017)
CrFP Total Peptides = 11 (0 Axonemal Peptides | 11 M+M Peptides | 0 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 2 (enriched 2 fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 14 | Dhc1b-3 M+M: 13 | Ift139-2 M+M: 14 (Total Unique Peptides)
Picariello Peptides (Picariello et al. Witman 2019) = Wild Type M+M: 15 | Ift140 ΔN-terminal WD repeat M+M: 11 (Total Unique Peptides)
Phytozome (gene name | defline): | Intraflagellar transport protein 54
Annotation v5.6 Symbol | Defline: IFT54 | Intraflagellar Transport Protein 54
Annotation v5.6 Description: belongs to peripheral subcomplex of IFT-B particle; similar to human TRAF3IP1
Annotation v5.6 Synonyms: g11669.t1#Cre22.g764600.t1.1#Cre22.g764600.t1.2
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: TRAF3IP1, NP_001132962.1, IFT54 TRAF3-interacting protein 1 isoform 2 [Homo sapiens] (Blast E value: 0 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: TRAF3IP1, TRAF3IP1 protein
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 3.38; at 10 min: 6.4; at 30 min: 6.91; at 60 min: 2.15
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre11.g467739
Phytozome Transcript: Cre11.g467739.t1.1
Protein Reference Source Peptide pLOGO
Cre11.g467739.t1.1--S243 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractSASPGGEDPLNKSApSPGGEDPLNK
Cre11.g467739.t1.1--S243(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractSASPGGEDPLNK
Cre11.g467739.t1.1--T332(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractVTKPVAVFTDNAKDNSDDEVEVVHEQTPVLSGGANMTGEQGVLVK
(Pan et al. Hippler 2011)Purified Flagella DNSDDEVEVVHEQTPVLSGGANMTGEQGVLVK
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
© Gregory J. Pazour