The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): RSP11 | "RSP11, Radial Spoke Protein 11"
Aliases: RSP11; PF25
Structure: Radial Spoke
References: (Yang et al. Witman 2006)
CrFP Total Peptides = 8 (5 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 3 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = (enriched fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 1 | Dhc1b-3 M+M: 0 | Ift139-2 M+M: 1 (Total Unique Peptides)
Phytozome (gene name | defline): RSP11 | Radial spoke protein 11
Annotation v5.6 Symbol | Defline: RSP11 | Radial Spoke Protein 11
Annotation v5.6 Description: Flagellar radial spoke protein 11 (RSP11) at radial spoke stalk; containing an RIIa domain initially found in the regulatory subunit of cAMP dependent protein kinase. Gene originally termed PF25 [PMID: 16507594; PMID: 7204490; PMID: 16267272; GI:83284717]
Annotation v5.6 Synonyms: g11400.t1#Cre10.g465250.t1.1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: ROPN1L, XP_016865436, ropporin-1-like protein isoform X3 [Homo sapiens] (Blast E value: 0 | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: ROPN1L, AF239723_1 AKAP-associated sperm protein
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 8.28; at 10 min: 13.3; at 30 min: 14.6; at 60 min: 4.04
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 507.81 FPKM | XAP Mutant: 121.31 FPKM | Fold Change: -2.07
CLIP Library: Cre10.g465250
Phytozome Transcript: Cre10.g465250.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T16YFTNLANVASGVSNSSAPAKEQLR
T16QPTDLIAFSAKYFTNLANVASGVSNSSAPAKEQLR
T15MDVEPIFCAEQIVIPHNLADILK
A38VMEVGAFTPAAVDLSK
A38QPTDLIAFSAK
A38RQPTDLIAFSAKYFTNLANVASGVSNSSAPAK
A37GGSGGATLTESQVTGLCQQAGIADAVVAK
A37RQPTDLIAFSAK
© Gregory J. Pazour