The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): PF6 | "PF6, Central Pair Protein PF6"
Aliases: PF6
Structure: Central Pair
References: (Dutcher et al. Luck 1984) (Rupp et al. Porter 2001)(Wargo et al. Smith 2005)
CrFP Total Peptides = 37 (27 Axonemal Peptides | 0 M+M Peptides | 3 KCl Peptides | 7 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 38 (enriched 1 fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 5 | Dhc1b-3 M+M: 12 | Ift139-2 M+M: 12 (Total Unique Peptides)
Picariello Peptides (Picariello et al. Witman 2019) = Wild Type M+M: 10 | Ift140 ΔN-terminal WD repeat M+M: 42 (Total Unique Peptides)
Phytozome (gene name | defline): | Flagellar central pair-associated protein
Annotation v5.6 Symbol | Defline: PF6 | Flagellar central pair-associated protein
Annotation v5.6 Description: Together with C1a-86, C1a-34, C1a-32, C1a-18, and calmodulin, forms the central pair projection C1a; may play a role in modulating both inner and outer dynein arm activity
Annotation v5.6 Synonyms: Cre10.g434400.t1.1#PF6#g10714.t1
Steve King Dynein Anotation: (no data) | (no data)
Yuqing Hou's Human Homologs: none, (no data), (no data) (Blast E value: (no data) | Reprocal Best Match? (no data))
Albee et al. Dutcher 2013 Human Homolog: (no data), (no data)
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid): (no data)
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 3.97; at 10 min: 9.05; at 30 min: 10.48; at 60 min: 2.74
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 357.7 FPKM | XAP Mutant: 101.47 FPKM | Fold Change: -1.82
CLIP Library: Cre10.g434400
Phytozome Transcript: Cre10.g434400.t1.2
Protein Reference Source Peptide pLOGO
Cre10.g434400.t1.2--S1567 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractRPSLMDPDAGSDAEDEYGNSRRPSLMDPDAGpSDAEDEYGNSR
(Pan et al. Hippler 2011)Purified Flagella ADEAEAALNESYLR
(Pan et al. Hippler 2011)Purified Flagella ADEAEAALNESYLR
(Pan et al. Hippler 2011)Purified Flagella AEEGEEEPPTPLDDEEGAAPVER
(Pan et al. Hippler 2011)Purified Flagella GASPAVGGHNVGGLDIPSLDETK
(Pan et al. Hippler 2011)Purified Flagella GLESAGGGQLPPVTSGR
(Pan et al. Hippler 2011)Purified Flagella LREPDEGSKPKPPPTPPPEPESVAEPEPEVK
(Pan et al. Hippler 2011)Purified Flagella PGSAAKPGAAPGAAYGMAVELR
(Pan et al. Hippler 2011)Purified Flagella QMAAESTARPGSAAKPGAAPGAAYGMAVELR
(Pan et al. Hippler 2011)Purified Flagella RPSLMDPDAGSDAEDEYGNSR
(Pan et al. Hippler 2011)Purified Flagella RPSLMDPDAGSDAEDEYGNSR
(Pan et al. Hippler 2011)Purified Flagella RPSLMDPDAGSDAEDEYGNSRR
(Pan et al. Hippler 2011)Purified Flagella TGGAAGTDFAYPELAHSQILAQHTER
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
© Gregory J. Pazour