The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): PF6 | "PF6, Central Pair Protein PF6"
Aliases: PF6
Structure: Central Pair
References: (Rupp et al. Porter 2001)
CrFP Total Peptides = 37 (27 Axonemal Peptides | 0 M+M Peptides | 3 KCl Peptides | 7 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 38 (enriched 1.17 fold by ciliary shortening)
Phytozome (gene name | defline): | Flagellar central pair-associated protein
O. Vallon Gene Name | Defline: PF6 | Flagellar central pair-associated protein
O. Vallon Description: Together with C1a-86, C1a-34, C1a-32, C1a-18, and calmodulin, forms the central pair projection C1a; may play a role in modulating both inner and outer dynein arm activity
O. Vallon Synonyms: Cre10.g434400.t1.1#PF6#g10714.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: none, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 3.97; at 10 min: 9.05; at 30 min: 10.48; at 60 min: 2.74
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 357.7 FPKM | XAP Mutant: 101.47 FPKM | Fold Change: -1.82
CLIP Library: Cre10.g434400
Phytozome Transcript: Cre10.g434400.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
Cre10.g434400.t1.2--S1567 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractRPSLMDPDAGSDAEDEYGNSRRPSLMDPDAGpSDAEDEYGNSR
(Pan et al. Hippler 2011)Purified Flagella ADEAEAALNESYLR
(Pan et al. Hippler 2011)Purified Flagella ADEAEAALNESYLR
(Pan et al. Hippler 2011)Purified Flagella AEEGEEEPPTPLDDEEGAAPVER
(Pan et al. Hippler 2011)Purified Flagella GASPAVGGHNVGGLDIPSLDETK
(Pan et al. Hippler 2011)Purified Flagella GLESAGGGQLPPVTSGR
(Pan et al. Hippler 2011)Purified Flagella LREPDEGSKPKPPPTPPPEPESVAEPEPEVK
(Pan et al. Hippler 2011)Purified Flagella PGSAAKPGAAPGAAYGMAVELR
(Pan et al. Hippler 2011)Purified Flagella QMAAESTARPGSAAKPGAAPGAAYGMAVELR
(Pan et al. Hippler 2011)Purified Flagella RPSLMDPDAGSDAEDEYGNSR
(Pan et al. Hippler 2011)Purified Flagella RPSLMDPDAGSDAEDEYGNSR
(Pan et al. Hippler 2011)Purified Flagella RPSLMDPDAGSDAEDEYGNSRR
(Pan et al. Hippler 2011)Purified Flagella TGGAAGTDFAYPELAHSQILAQHTER
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T25KSASQSAVGSR
T25MAPELAAGVEAHQR
T25SASQSAVGSR
T25AAGEALAAYHR
T25TSSTQLIR
T25GASPAVGGHNVGGLDIPSLDETK
T25GGSCAFYESEQLR
C32LANVSTGAAR
C06LQAAQDDATAAAAGLTAAHEAVK
C06LAEEEAAR
A06YQLLQAAVDLLPPSAK
A06LDAVEGWLGPDGAAAAR
A06ETSDAAAVAR
A06AGADDDEEDDDDGGRPAK
A05ELLELPALSGETIATIR
A05STAADLPVAMNLSAFVR
A05LGATGASIMSR
A05AKAGADDDEEDDDDGGRPAK
A05TLNQVIHGDATGGAGAEEPAPEPAP
A05AAVVAAEVQVR
A05VSVPLVMHALLEQVAR
A05TALQAEAEALPVATIER
A05SHAYDVYGQPR
A05EAPAEEVALEQAK
A05RRETSDAAAVAR
A05LDPATPLGQEAK
A05AAAAAPGPVDLPAK
A05LTSPLAGASR
A05VMSYEPPVVR
A05GVEEEEARK
A04ADEAEAALNESYLR
A04GLESAGGGQLPPVTSGR
A04TRLQAAQDDATAAAAGLTAAHEAVK
A04GVAVHGAPLPGADLAALR
A04FFLLGPLAR
A04LSHEDAILAR
A04GVEEEEAR