The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP201 | "FAP201, Leucine Rich Repeat Flagellar Associated Protein 201"
Aliases: FAP201
Structure:
References:
CrFP Total Peptides = 12 (3 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 9 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 5 (enriched 1.2 fold by ciliary shortening)
Phytozome (gene name | defline): | Similar to Flagellar Associated Protein FAP201
Annotation v5.6 Symbol | Defline: FAP201 | Leucine Rich Repeat Flagellar Associated Protein 201
Annotation v5.6 Description: NULL
Annotation v5.6 Synonyms: g9879.t2#Cre02.g135050.t1.1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: NLRC3, NP_849172.2, protein NLRC3 [Homo sapiens] (Blast E value: 0 | Reprocal Best Match? No)
Albee et al. Dutcher 2013 Human Homolog: LRRC34, leucine rich repeat containing 34, isoform CRA_b
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 3.96; at 10 min: 8.34; at 30 min: 11.25; at 60 min: 3.94
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 13.27 FPKM | XAP Mutant: 3.46 FPKM | Fold Change: -1.94
CLIP Library: Cre09.g397993
Phytozome Transcript: Cre09.g397993.t2.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T09HNPIGDTGALAVADMLR
T08LTLASNSLGNDGASALAR
T08AVAEALAAPALR
T08LMQVNPGLQLLDLTGNEVTDK
T08LVDSQLELLTTYGFAR
T08GLIGLANALTAPEGNR
T08CRLVDSQLELLTTYGFAR
T08SLQVLDLEDAQLAAPQDSTYQHMSR
T08LMQVNPGLQLLDLTGNEVTDKGAAAITEVLAKPEAGLK
A29LPYNFLNDMAAQAVAR
A29MLATNTTLTELSLAK
A29GAAAITEVLAKPEAGLK
© Gregory J. Pazour