The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP201 | "FAP201, Leucine Rich Repeat Flagellar Associated Protein 201"
Aliases: FAP201
Structure:
References:
CrFP Total Peptides = 10 (3 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 7 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 5 (enriched 1 fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 0 | Dhc1b-3 M+M: 1 | Ift139-2 M+M: 0 (Total Unique Peptides)
Phytozome (gene name | defline): | Similar to Flagellar Associated Protein FAP201
Annotation v5.6 Symbol | Defline: FAP201 | Leucine Rich Repeat Flagellar Associated Protein 201
Annotation v5.6 Description: NULL
Annotation v5.6 Synonyms: g9879.t2#Cre02.g135050.t1.1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: NLRC3, NP_849172.2, protein NLRC3 [Homo sapiens] (Blast E value: 0 | Reprocal Best Match? No)
Albee et al. Dutcher 2013 Human Homolog: LRRC34, leucine rich repeat containing 34, isoform CRA_b
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 3.96; at 10 min: 8.34; at 30 min: 11.25; at 60 min: 3.94
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 13.27 FPKM | XAP Mutant: 3.46 FPKM | Fold Change: -1.94
CLIP Library: Cre09.g397993
Phytozome Transcript: Cre09.g397993.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T09HNPIGDTGALAVADMLR
T08LTLASNSLGNDGASALAR
T08AVAEALAAPALR
T08LMQVNPGLQLLDLTGNEVTDK
T08GLIGLANALTAPEGNR
T08SLQVLDLEDAQLAAPQDSTYQHMSR
T08LMQVNPGLQLLDLTGNEVTDKGAAAITEVLAKPEAGLK
A29LPYNFLNDMAAQAVAR
A29MLATNTTLTELSLAK
A29GAAAITEVLAKPEAGLK
© Gregory J. Pazour