The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): DHC2 | "DHC2, Axonemal Dynein Heavy Chain 2"
Aliases: DHC2
Structure: Inner Arm Dynein
References: (Hom et al. King 2011)
CrFP Total Peptides = 50 (18 Axonemal Peptides | 2 M+M Peptides | 27 KCl Peptides | 3 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 80 (enriched 1.16 fold by ciliary shortening)
Phytozome (gene name | defline): | "Dynein heavy chain 2, inner arm dynein d (monomeric)"
O. Vallon Gene Name | Defline: DHC2 | Axonemal Dynein Heavy Chain 2
O. Vallon Description: Flagellar inner arm dynein heavy chain, dynein d (monomeric). Identified in Chlamydomonas flagella in mass spec proteomic study by Yagi et al. [PMID: 19351714]
O. Vallon Synonyms: DHC2#g9720.t1#Cre02.g127950.t1.2#Cre02.g127950.t1.1
Steve King Dynein Anotation: DHC2 |
Yuqing Hou's Human Homologs: DNAH1; DNAH6, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: DNAH1, dynein heavy chain 1, axonemal
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 0.86; at 10 min: 7.01; at 30 min: 11.19; at 60 min: 5.88
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre09.g392282
Phytozome Transcript: Cre09.g392282.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T25TSANQTQDIIDAK
T24PGVAVLGTK
T24SLQNPPAGVR
C06TLNVSNK
C05LGGAPAGPAGTGKTETTK
C05TQGLHTLEPAIMENLFWATAPVLSTVHQQEEIVVR
C05YTYVVDKLVANQR
C04RYNYVTPTSYLELLTTFIK
C04GTNLLSTLQDPVKVR
C04ANNLEDVDEQR
C04LAAAGDSKYER
C04ARQEALLTENFGLGYGDVVTSER
C04YLLPEEDLKEK
C04FVYSTQPESIVTK
C04SQLVVSNAK
C04WDNQTHVIAESRPK
C04QVEQQEKDANEQAAR
C04MPEVDYNSLLK
C04DVVAELAEAK
C04RPGVPLTSGR
C04WPLMIDPQGQANK
C04SVITAAGNLKR
C04ELSDIEDR
C04VSLLNFFVTPEGLEDQLLGTVVTQERPDLANLK
C04EALLGLPPTDYSPLKK
C04LVITPLTDR
C04YNLYVDSMPTDDIPPLTNEQVNR
C04IGDNIIPYHPDFR
C03LGGAPAGPAGTGK
C03GEGEDPLTADEKVK
B03LIFGDFMVPGADPR
B03YFAQPPIELLR
A04VAEAEATER
A03LPLGNALLLGVGGSGR
A03VIQLYETTIVR
A03ILQLLSASSGEILDDEELINTLAQSK
A03LLNTAGQVEVMQK
A03VVFDTALTAAR
A03IATLEAQYEEALAK
A03VYSQITDMPK
A03SSLVHEWSGFLEAAKVPATK
A03LGAIFNALVPDALR
A03ELQELQPVLAATAK
A03VSLGQGQGPK
A03VTSNEISAK
A03TETTKDLAK
A03ESSPSVPLIFVLSPGADPMADLLK
A03VMAPFETR
A03EIDETR
A03NDIVEVK