The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP180 | "FAP180, Flagellar Associated Protein 180; Similar to Uridylate and Adenylate Kinases"
Aliases: FAP180; ADK5
Structure:
References:
CrFP Total Peptides = 27 (1 Axonemal Peptides | 10 M+M Peptides | 15 KCl Peptides | 1 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 24 (enriched 1.27 fold by ciliary shortening)
Phytozome (gene name | defline): | Adenylate kinase; Flagellar Associated Protein
O. Vallon Gene Name | Defline: FAP180 | Flagellar Associated Protein 180
O. Vallon Description: Contains adenylate and gualylate kinase domains, and calmodulin binding IQ motifs and a C-terminal Dpy30 motif; linked to ADK6; found in the flagellar proteome and previously annotated as FAP18 and FAP121; null-allele passenger mutation was isolated (PMID
O. Vallon Synonyms: FAP180#FAP121#g8886.t1#ADK5
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: AK1, NP_000467.1, ADK5 [Cr] adenylate kinase isoenzyme 1 [Homo sapiens] (Blast E value: 5.00E-47 | Reprocal Best Match? No)
Albee et al. Dutcher 2013 Human Homolog: GUK1, guanylate kinase isoform b
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 6.93; at 10 min: 15.79; at 30 min: 11.95; at 60 min: 1.67
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre08.g377350
Phytozome Transcript: Cre08.g377350.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
Cre08.g377350.t1.1--S967 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractLPTPPSAPAPPPAAAAPRLPTPPpSAPAPPPAAAAPR
Cre08.g377350.t1.1--T964 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractLPTPPSAPAPPPAAAAPRLPpTPPSAPAPPPAAAAPR
Cre08.g377350.t1.1--S967(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractLPTPPSAPAPPPAAAAPR
(Pan et al. Hippler 2011)Purified Flagella LLPGTFKPADLRPPSAAR
(Pan et al. Hippler 2011)Purified Flagella LPTPPSAPAPPPAAAAPR
(Pan et al. Hippler 2011)Purified Flagella LPTPPSAPAPPPAAAAPR
(Pan et al. Hippler 2011)Purified Flagella LPTPPSAPAPPPAAAAPR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T28GTETEDKVQLR
C21GATSGRADDNEDTIR
C14IVNDDLDAAYHR
C11KAGAEAYSAEQEAAILR
C11KLEQLQEFEGR
C11VAAIKAER
C10AAAGKAEAQAQAAEFEAR
C10VAVLDIDVQGASR
C10QAEGAPAAEAQAEAEAEVAAEALADAEEAAK
C10MDDQVANIR
C10QYMDATVVPVLR
C10DFDSQIKPCDGVLVFSVPEDVAVER
C10LPTPPSAPAPPPAAAAPR
C10TLDQLRDFDSQIKPCDGVLVFSVPEDVAVER
C10MQVFQEESQPVIEFLR
C09AEAQAQAAEFEAR
B08ADDNEDTIR
B08FLVDGFPR
B07AGAEAYSAEQEAAILR
B07IKPCDGVLVFSVPEDVAVER
B07AVYVFVDPPSMQELEAR
B07ALNEERPADPLQYLADFFQEAR
B07SHEPGFFDAR
B07NSTAEIER
B07GRGTETEDKVQLR
B07LKNSTAEIER
A41DLIKAR