The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP29 | "FAP29, von Willebrand Factor Type A Domain Flagellar Associated Protein 29"
Aliases: FAP29
Structure: Membrane
References:
CrFP Total Peptides = 3 (0 Axonemal Peptides | 3 M+M Peptides | 0 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 9 (enriched 1.28 fold by ciliary shortening)
Phytozome (gene name | defline): FAP29 | Flagellar Associated Protein
O. Vallon Gene Name | Defline: FAP29 | von Willebrand Factor Type A Domain Flagellar Associated Protein 29
O. Vallon Description: Flagellar Associated Protein, found in flagellar proteome. Contains type A von Willebrand factor domain
O. Vallon Synonyms: Cre08.g364300.t1.1#g8530.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: ITIH5, NP_001001851, inter-alpha-trypsin inhibitor heavy chain H5 isoform 3 precursor [Homo sapiens] (Blast E value: 6.00E-06 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: ITIH4, inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 3.44; at 10 min: 7.25; at 30 min: 6.07; at 60 min: 0.72
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre08.g364300
Phytozome Transcript: Cre08.g364300.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
B16GLTDIMTPLQTAMR
B15SVVFLLDR
B15ANYKPASAVDASGAAVPEAHLNDPELFVLPMPGR