The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): RSP7 | "RSP7, Radial Spoke Protein 7"
Aliases: RSP7
Structure: Radial Spoke
References: (Yang et al. Witman 2006)
CrFP Total Peptides = 15 (9 Axonemal Peptides | 0 M+M Peptides | 3 KCl Peptides | 3 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 8 (enriched 1.17 fold by ciliary shortening)
Phytozome (gene name | defline): RSP7 | Radial spoke protein 7
O. Vallon Gene Name | Defline: RSP7 | Radial Spoke Protein 7
O. Vallon Description: A subunit in the radial spoke stalk with multiple EF-hands tethered to an RIIa domain [PMID: 16507594; GI:83284725]
O. Vallon Synonyms: Cre07.g347050.t1.1#g8077.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: CALML5, AAH39172.1, Calmodulin-like 5 [Homo sapiens] (Blast E value: 0 | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: CALML5, calmodulin-like protein 5
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 5.34; at 10 min: 10.39; at 30 min: 14.35; at 60 min: 6.15
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 512 FPKM | XAP Mutant: 82.8 FPKM | Fold Change: -2.63
CLIP Library: Cre07.g347050
Phytozome Transcript: Cre07.g347050.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T01EFLPIMVDILQSIK
T01DINLILSHIDVDRDGLVSYEEFIPVCFQVLVER
T01TEVETMLLHGLPQEELQALMLK
C24AAPVEPASTSHAATSK
C23VDTEGAGQLTLPQVTQVLDGLNSLAPDANLALSDQHMK
C23AQPSNIYEFGAR
A26SSTYQKPITIPGDFPAILK
A26ADADGSGQLNR
A25AVAEAGGIAALGALDLDQLR
A25YFSGLQGQAEPEGLGR
A25DADPDNTGLLSQR
A25KADADGSGQLNR
A25LFIEADADR
A25SGFLDRHEFTAVLR
A25ATDVEETAVMFDIAALTPAELEPILMK