The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): RSP9 | "RSP9, Radial Spoke Protein 9"
Aliases: RSP9; PF17
Structure: Radial Spoke
References: (Yang et al. Witman 2006)
CrFP Total Peptides = 17 (7 Axonemal Peptides | 0 M+M Peptides | 1 KCl Peptides | 9 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 10 (enriched 1 fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 5 | Dhc1b-3 M+M: 5 | Ift139-2 M+M: 6 (Total Unique Peptides)
Phytozome (gene name | defline): RSP9 | Radial spoke protein 9
Annotation v5.6 Symbol | Defline: RSP9 | Radial Spoke Protein 9
Annotation v5.6 Description: A subunit in the flagellar radial spoke head; gene originally termed PF17 [PMID: 7204490, PMID: 16507594; GI:83284713]
Annotation v5.6 Synonyms: Cre07.g330200.t1.1#g7684.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: RSPH9, NP_689945 , radial spoke head protein 9 homolog isoform 1 [Homo sapiens] (Blast E value: 0 | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: RSPH9, radial spoke head protein 9 homolog isoform 1
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 7.63; at 10 min: 12.1; at 30 min: 13.9; at 60 min: 4.07
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 1968.2 FPKM | XAP Mutant: 950.31 FPKM | Fold Change: -1.05
CLIP Library: Cre07.g330200
Phytozome Transcript: Cre07.g330200.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T14FSLPGSGVTLSQDLR
T14GTWAVQYDAFKGVAQVR
T14FSLPGSGVTLSQDLRGTWAVQYDAFKGVAQVR
T14VQLEPNITLVLK
T14GMLSGDPAK
T14RIEAGLR
T14LTTLNGKDYLVAEGYNVASSK
T14GTWAVQYDAFK
T13NNDLIFML
C34LFAGAAYPEKLESYQHR
A36EGAAVYETK
A36YFYSQDGAR
A35DYLVAEGYNVASSK
A35WSDLQPVDSETATR
A35IKGMLSGDPAK
A35LFAGAAYPEK
A35NYELEEK
© Gregory J. Pazour