The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP81 | "FAP81, Flagellar Associated Protein 81; Similar to DLEC1 deleted in lung and esophageal cancer 1"
Aliases: FAP81; Dlec1; CFAP81
Structure:
References:
CrFP Total Peptides = 18 (12 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 6 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 30 (enriched 1.2 fold by ciliary shortening)
Phytozome (gene name | defline): FAP81 | Flagellar Associated Protein
O. Vallon Gene Name | Defline: FAP81 | Flagellar Associated Protein 81
O. Vallon Description: Similar to DLEC1 deleted in lung and esophageal cancer 1
O. Vallon Synonyms: g6864.t1#Cre06.g296850.t1.1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: DLEC1, NP_031361.2, deleted in lung and esophageal cancer protein 1 isoform DLEC1-N1 [Homo sapiens] ; pf32p, a novel central-pair-projection protein required for flagellar beating with a regular periodicity. (Blast E value: 9.00E-44 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: DLEC1, DLEC1 protein
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 2.04; at 10 min: 9.75; at 30 min: 9.51; at 60 min: 2.5
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 186.25 FPKM | XAP Mutant: 68.8 FPKM | Fold Change: -1.44
CLIP Library: Cre06.g296850
Phytozome Transcript: Cre06.g296850.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
Cre06.g296850.t1.2--S1009 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractFAEAQRSPAASTSGALVALPASAAERFAEAQRpSPAASTSGALVALPASAAER
Cre06.g296850.t1.2--S1015(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractFAEAQRSPAASTSGALVALPASAAER
(Pan et al. Hippler 2011)Purified Flagella EAKEEAAAAAAAAGGGGSASAQPTPR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T26SASGGNLAGEASAPDSR
T26ATVDNPAIAVSPSEFR
T26INFGDVPLSGSSEQR
T26FPTLPGAGAAASAAAAK
T26HASTSAAGSK
T26SPAASTSGALVALPASAAERR
A08MLDPQAAAAAIDALVQEEEEAEAAAAAREEEEAVGYR
A08IKPDHGELEPGEDVEIQVR
A06TFSLSGNAVGVDVLLHSVDGR
A06LQEEADEALGNK
A06ELTPALVAAEK
A06QTLYLTNLSQLPVLYR
A06IAEYADTSAKPNYLK
A06WTAEAEDEGSQTAGLAELK
A06SPAASTSGALVALPASAAER
A06AYEQVVR
A06IGPYVVKPASGVLSGR
A05AAVGSSYAR