The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP3 | "FAP3, Hydroxyproline-Rich Flagellar Associated Protein 3"
Aliases: FAP3; GP2; CWP2
Structure:
References:
CrFP Total Peptides = 14 (3 Axonemal Peptides | 0 M+M Peptides | 10 KCl Peptides | 1 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 8 (enriched 2 fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 7 | Dhc1b-3 M+M: 9 | Ift139-2 M+M: 5 (Total Unique Peptides)
Phytozome (gene name | defline): | Hydroxyproline-rich glycoprotein component of the outer cell wall
Annotation v5.6 Symbol | Defline: GP2 | Hydroxyproline-rich glycoprotein component of the outer cell wall
Annotation v5.6 Description: Extracellular matrix protein (cell wall protein) GP2; contains (hydroxy)proline-rich (HR) domains. Antibody against deglycosylated GP2 was used successfully to screen for a cDNA clone in a gt11 expression library [PMID: 1699225; M58497]. Independently seq
Annotation v5.6 Synonyms: GP2#CWP2#g5819.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: none, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: ; at 10 min: ; at 30 min: ; at 60 min:
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre06.g258800
Phytozome Transcript: Cre06.g258800.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
Cre06.g258800.t1.1--T686(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractNPDCSLLATLVQSTFTQGVQLR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T29AGSPGAGVCIDKLPV
C13IGEAEPPR
C07YTSWMNAMMDSFER
C07AGATQGPLPSKDLSGAAGSSLFLAAEYSIVK
C07DGSGQPYPTSEQNK
C07LGAIPQNTNYQR
C07IGEAEPPRQK
C06ITVAAQQSAHDAVMDFILSGGDFVR
C05TYEIFAPFKGTGGR
C05DGSGQPYPTSEQNKWAADAVTSMFAVLGSSELWK
C02AAVDPYLYLSGK
A09LYNPAGGGFFTDYR
A04CGTTVSATEISAVADTLTTEGAQVFLR
A04AGATQGPLPSK
© Gregory J. Pazour