The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): DHC16 | "DHC16 (DHC1b), Cytoplasmic Dynein 1b Heavy Chain"
Aliases: DHC16; DHC1b
Structure: Intraflagellar Transport
References: (Pazour et al. Witman 1999)(Porter et al. Dentler 1999)(Hom et al. King 2011); Ciliary level increases during disassembly (Wang et al. Pan 2017)
CrFP Total Peptides = 82 (0 Axonemal Peptides | 78 M+M Peptides | 4 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 114 (enriched 2.51 fold by ciliary shortening)
Phytozome (gene name | defline): DHC1B | Cytoplasmic dynein 1b heavy chain (not an inner arm dynein)
O. Vallon Gene Name | Defline: DHC16 | Cytoplasmic Dynein 1b Heavy Chain
O. Vallon Description: Homologue of mammalian cytoplasmic dynein 2 heavy chain. Motor for retrograde intraflagellar transport. Not an inner arm dynein. Upregulated upon deflagellation by nearly 8-fold; null-allele mutant was isolated (PMID 29743196)
O. Vallon Synonyms: g5606.t1#DHC1b#Cre06.g250300.t1.1#FLA24
Steve King Dynein Anotation: DHC16 | DHC1b dynein heavy chain
Yuqing Hou's Human Homologs: DYNC2H1, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: DYNC2H1, cytoplasmic dynein 2 heavy chain 1 isoform 1
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 0.67; at 10 min: 4.15; at 30 min: 4.28; at 60 min: 2.87
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre06.g250300
Phytozome Transcript: Cre06.g250300.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
(Pan et al. Hippler 2011)Purified Flagella RLSELLAQVQAGLGTAVR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
C05SQTAEGVPVLDKR
C05ERPELEEQK
C05GALPSQQQR
C05LQSSLEESQR
B05SGLEGQLLGLTLQK
B05GGVAGDEGSGGAALR
B05TQVLEQQNFLK
B05SGPSGNPAVVLAK
B05ALINDLFPGAK
B05ISVDKAESVLSSAR
B05GLQQIAAAR
B05FYEFSFADLR
B05GDLWSAPFGEVR
B05LQYDPPLEELR
B05AVLVGASGLMTR
B04LWDQLMSGASALK
B04LTELVESSPELMK
B04ITEQIETWLGDLTR
B04AAAGGAPVALLGGLIMQGATFDGSR
B04NAAALDGYVR
B04LSPVAAEAPAFR
B04EWSDGVLTAAAR
B04VYAAAESLFTQLADELKK
B03VTGQNVEVTTMADQR
B03YSLEGGLTLVQAIAHEGLR
B03DAMTEVGDNQSLVASLK
B03QANTVEDIGLAGQEAK
B03VKVEEELSEVQPLIDAAR
B03NIASALQSEKETLAK
B03SLDAQAQGEAVIR
B03VYAAAESLFTQLADELK
B03GLGSNMNPDIR
B03YFEVAMGQGQAEK
B03VQIVGSMTPPGSVGR
B03SGMDVITLATR
B03TLVVAEVDKVEPILYPLLR
B03EYLALVSLYGQIYNR
B03LFSAETVGAAGGK
B03AEGLPADGLSAQNAVVILNSTSR
B03QQLLGSMNMDTR
B03SVAATKLPTLTFDDNSRFK
B03YKGASLVALIDR
B03VVGAALATYVQR
B03ALGQALAR
B03AAAGGSLIQPQQVFAEIK
B03IGGTTEWGWTR
B03ETVTLTHFLEK
B03LDNPFDSQVLLTFLR
B03ELLSPQQHYDWGLR
B03VSVAAAPMAQWFK
B03QSFEQLSSDAPEGEGGSIGWEGAKELVDLTTNALR
B03ALIEGETRPDEPVLFITTPGADPSQELSEYAAQTMGK
B03TAQQVNSAR
B03QLQSLGFGVR
B03NPAVIQSHLK
B03KLFAGIQK
B03VTASIVER
B03STLWELLEK
B03NGDWLVLK
B03AQWQAQLGPLLR
B03NPDPYLPPDAR
B03LGVDTGGHDWEGAAFADAYVR
B03LAEVQAAR
B03LAEAAVTVDTLSAEAEKQR
B03ELVDLTTNALR
B03SLLAVTNFTVTR
B03LEAEGYSR
B03AMLEVYSSVR
B03TASSVSPAALSK
B03NEALEK
B03IGVIIVGPSGSGK
B03TSGPAAVSK
B03TSEAETLK
B02LSELLAQVQAGLGTAVR
B02QYEEELVQLDAAVASLK
B02SPLIIDPSTQASEWLK
B02EFTFTESTQSVAGR
B02SSALQVSSALEPLR
B02TLQASLDQQR
B02ELNLLLFPEVLER
B02RVKVEEELSEVQPLIDAAR
B02WKAEGLPADGLSAQNAVVILNSTSR