The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): RSP4 | "RSP4, Radial Spoke Protein 4"
Aliases: RSP4; PF1
Structure: Radial Spoke
References: (Yang et al. Witman 2006); Loss of Rsph6a causes male sterility in mouse. Not clear if Rsph6a is orthologous to Rsp4 or Rsp6 Abbasi et al. Ikawa 2018)
CrFP Total Peptides = 8 (3 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 5 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 9 (enriched 1 fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 5 | Dhc1b-3 M+M: 5 | Ift139-2 M+M: 5 (Total Unique Peptides)
Phytozome (gene name | defline): RSP4 | Radial spoke protein 4
Annotation v5.6 Symbol | Defline: RSP4 | Radial spoke protein 4
Annotation v5.6 Description: Flagellar radial spoke protein 4 (RSP4), a component of the radial spoke head; gene originally termed PF1 [PMID: 7204490; PMID: 1508197; PMID: 16507594; GI:401050]
Annotation v5.6 Synonyms: Cre05.g242500.t1.1#g5301.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: RSPH6A, NP_110412, radial spoke head protein 6 homolog A [Homo sapiens] (Blast E value: 0 | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: RSPH6A, radial spoke head protein 6 homolog A
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 6.48; at 10 min: 9.14; at 30 min: 9.92; at 60 min: 3.18
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 611.83 FPKM | XAP Mutant: 149.89 FPKM | Fold Change: -2.03
CLIP Library: Cre05.g242500
Phytozome Transcript: Cre05.g242500.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T05GSEWTCVYVGWGVK
T05LPDVTPAQVK
T04NAVDLLETSLLVK
T04AAVDSVAQALAYLQVHSPQDGTSMYDHLVK
T04FTYLVCSSLGGPLTRLPDVTPAQVK
A22EAAPAAPAPER
A21ISAATVVAPSDLFSLNDETGELER
A21VLEDQPK
© Gregory J. Pazour