The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP30 | "FAP30, Flagellar Associated Protein 30; Similar to hyalin-domain proteins"
Aliases: FAP30
Structure: Membrane
References: (no data)
CrFP Total Peptides = 9 (8 Axonemal Peptides | 0 M+M Peptides | 1 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = (no data) (enriched (no data) fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: (no data) | Dhc1b-3 M+M: (no data) | Ift139-2 M+M: (no data) (Total Unique Peptides)
Picariello Peptides (Picariello et al. Witman 2019) = Wild Type M+M: (no data) | Ift140 ΔN-terminal WD repeat M+M: (no data) (Total Unique Peptides)
Phytozome (gene name | defline): | (1 of 1) PF02494 - HYR domain (HYR)
Annotation v5.6 Symbol | Defline: FAP30 | Flagellar Associated Protein 30
Annotation v5.6 Description: Similar to hyalin-domain proteins
Annotation v5.6 Synonyms: g4881.t1
Steve King Dynein Anotation: (no data) | (no data)
Yuqing Hou's Human Homologs: SVEP1, (no data), (no data) (Blast E value: (no data) | Reprocal Best Match? (no data))
Albee et al. Dutcher 2013 Human Homolog: SVEP1, SVEP1 protein
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid): (no data)
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 0.79; at 10 min: 3.03; at 30 min: 1.57; at 60 min: 0.71
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: (no data) FPKM | XAP Mutant: (no data) FPKM | Fold Change: (no data)
CLIP Library: Cre04.g223650
Phytozome Transcript: Cre04.g223650.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
C11DTTAPTVSTSTNAITK
A10KSDVGEFLADALANLK
A10LTPTQAVMTFQGK
A10WPLSNPAWGQIAPGYPK
A10SFSTGTEYDGMTTLLVTKPAILAK
A10SDVGEFLADALANLK
A10SFSTGTEYDGMTTLLVTKPAILAKDQVFTFK
A10DQVFTFK
A09GTAGDADVTAAVK
© Gregory J. Pazour