The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP30 | "FAP30, Flagellar Associated Protein 30; Similar to hyalin-domain proteins"
Aliases: FAP30
Structure: Membrane
References:
CrFP Total Peptides = 9 (8 Axonemal Peptides | 0 M+M Peptides | 1 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = (enriched fold by ciliary shortening)
Phytozome (gene name | defline): | (1 of 1) PF02494 - HYR domain (HYR)
O. Vallon Gene Name | Defline: FAP30 | Flagellar Associated Protein 30
O. Vallon Description: Similar to hyalin-domain proteins
O. Vallon Synonyms: g4881.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: SVEP1, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: SVEP1, SVEP1 protein
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 0.79; at 10 min: 3.03; at 30 min: 1.57; at 60 min: 0.71
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre04.g223650
Phytozome Transcript: Cre04.g223650.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
C11DTTAPTVSTSTNAITK
A10KSDVGEFLADALANLK
A10LTPTQAVMTFQGK
A10WPLSNPAWGQIAPGYPK
A10SFSTGTEYDGMTTLLVTKPAILAK
A10SDVGEFLADALANLK
A10SFSTGTEYDGMTTLLVTKPAILAKDQVFTFK
A10DQVFTFK
A09GTAGDADVTAAVK