The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): IFT52 | "IFT52, Intraflagellar Transport Protein 52"
Aliases: IFT52; BLD1; NGD5
Structure: Intraflagellar Transport
References: (Cole et al. Rosenbaum 1997)(Brazelton et al. Lefebvre 2001)(Pazour et al. Besharse 2002)(Follit et al. Pazour 2009)(Cole 2003)(Cole 2003); Ciliary level increases during disassembly (Wang et al. Pan 2017)
CrFP Total Peptides = 4 (0 Axonemal Peptides | 4 M+M Peptides | 0 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 5 (enriched 2.61 fold by ciliary shortening)
Phytozome (gene name | defline): IFT52 | Intraflagellar transport protein 52
O. Vallon Gene Name | Defline: IFT52 | Intraflagellar transport protein 52
O. Vallon Description: Component of core of IFT-B particle; contains ABC-type uncharacterized transport domain; mutated in bld1 mutant; the C. elegans homologue of IFT52/BLD1 is osm-6. [PMID: 11676918, PMID: 11676919, Genbank entry AF397450].
O. Vallon Synonyms: Cre04.g219250.t1.1#BLD1#g4778.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: IFT52, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: IFT52, intraflagellar transport protein 52 homolog
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 4.21; at 10 min: 7.46; at 30 min: 6.73; at 60 min: 2.07
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 1102.18 FPKM | XAP Mutant: 358.75 FPKM | Fold Change: -1.62
CLIP Library: Cre04.g219250
Phytozome Transcript: Cre04.g219250.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
B26IQLNDIDAEEPDVSDLK
B22SLNSNDDDEFR
B22YLHPKEVLISDGILNR
B21GPQAFDGTGLEYVFPFGATLSVQKPAVPVLSSGK