The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): PHOT1 | "PHOT1, Blue Light Receptor 1; PAS and Kinase Domain Containing Flagellar Associated Protein"
Aliases: PHOT1; PHT1
Structure:
References: (Huang et al. Beck 2004)
CrFP Total Peptides = 27 (6 Axonemal Peptides | 9 M+M Peptides | 11 KCl Peptides | 1 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 19 (enriched 1.05 fold by ciliary shortening)
Phytozome (gene name | defline): PHOT1 | Phototropin
O. Vallon Gene Name | Defline: PHOT1 | Phototropin
O. Vallon Description: Blue-light receptor; found in flagella; regulates many biological processes including gametogenesis, chemotaxis, zygote maturation, light-stress response; contains two PAS and two protein kinase domains
O. Vallon Synonyms: PHOT#PHT1#g4349.t1#Cre03.g199000.t1.1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: PRKACB, XP_005271075.1, cAMP-dependent protein kinase catalytic subunit beta isoform X5 [Homo sapiens] (Blast E value: 2.00E-55 | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: ; at 10 min: ; at 30 min: ; at 60 min:
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre03.g199000
Phytozome Transcript: Cre03.g199000.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
Cre03.g199000.t1.2--S592 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractSGGSSSGSALQLENYLLLAEPSARSGGSSSGpSALQLENYLLLAEPSAR
Cre03.g199000.t1.2--S577 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractIGGAGAAGGSAPKSPKIGGAGAAGGSAPKpSPK
Cre03.g199000.t1.2--T741 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractAAGGSSTGGAAFDNYAAGGSSpTGGAAFDNY
Cre03.g199000.t1.2--S739(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractAAGGSSTGGAAFDNY
Cre03.g199000.t1.2--S592(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractSGGSSSGSALQLENYLLLAEPSAR
Cre03.g199000.t1.2--S577(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractIGGAGAAGGSAPKSPK
(Pan et al. Hippler 2011)Purified Flagella ANSFVGTEEYLAPEVINAAGHGPAVDWWSLGILIFELLYGTTPFR
(Pan et al. Hippler 2011)Purified Flagella ANSFVGTEEYLAPEVINAAGHGPAVDWWSLGILIFELLYGTTPFR
(Pan et al. Hippler 2011)Purified Flagella ANSFVGTEEYLAPEVINAAGHGPAVDWWSLGILIFELLYGTTPFR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
(Pan et al. Hippler 2011)Purified Flagella SGGSSSGSALQLENYLLLAEPSAR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T22SGGSSSGSALQLENYLLLAEPSAR
C23AYQALLQLQER
C22VKQLGAGDVGLVDLVQLQGSELK
C22ALADNSGVPLLVK
C22ADDKAYQALLQLQER
C22DLKPENILLHHTGHVLLTDFDLSYSK
C19FLQGEGTDPKEVQK
C19DGTPFWNLLTVTPIK
C19FLQGAGTDR
C19KDGTPFWNLLTVTPIKTPDGR
C19LKEEHVR
C18IGGAGAAGGSAPK
B37KGEACSVR
B36FVGVQVDVTSKTEGK
B36VSKFVGVQVDVTSKTEGK
B35GINWALLR
B34AGVPAPASQLTKVLAGLR
B32TLDKFEMQER
B25AEGVEPGQASAVAAAAPLGAK
B25AAIKEGSELTVR
B20VALDLATTVER
A19DGTPFWNLLTVTPIKTPDGR
A19QLGAGDVGLVDLVQLQGSELK
A19RDETFENIIK
A19TPEEEVAK
A19AFWNMFTLAPMR
A19AGVPAPASQLTK