The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP123 | "FAP123, Flagellar Associated Protein 123"
Aliases: FAP123
CrFP Total Peptides = 10 (1 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 9 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = (enriched fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 0 | Dhc1b-3 M+M: 0 | Ift139-2 M+M: 1 (Total Unique Peptides)
Picariello Peptides (Picariello et al. Witman 2019) = Wild Type M+M: 0 | Ift140 ΔN-terminal WD repeat M+M: 8 (Total Unique Peptides)
Phytozome (gene name | defline): FAP123 | Flagellar Associated Protein
Annotation v5.6 Symbol | Defline: FAP123 | Flagellar Associated Protein
Annotation v5.6 Description: Flagellar Associated Protein, found in the flagellar proteome
Annotation v5.6 Synonyms: Cre03.g171800.t1.1#g3541.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: ODF3B, NP_001014440.2, outer dense fiber protein 3B [Homo sapiens] (Blast E value: 0 | Reprocal Best Match? No)
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 3.59; at 10 min: 5.29; at 30 min: 3.53; at 60 min: 1.56
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 2106.5 FPKM | XAP Mutant: 406.59 FPKM | Fold Change: -2.37
CLIP Library: Cre03.g171800
Phytozome Transcript: Cre03.g171800.t1.2
Protein Reference Source Peptide pLOGO
(Pan et al. Hippler 2011)Purified Flagella GTQGPPPGSYELPGALGPQVIKPSSPSFSLPR
(Pan et al. Hippler 2011)Purified Flagella GTQGPPPGSYELPGALGPQVIKPSSPSFSLPR
(Pan et al. Hippler 2011)Purified Flagella GTQGPPPGSYELPGALGPQVIKPSSPSFSLPR
(Pan et al. Hippler 2011)Purified Flagella GTQGPPPGSYELPGALGPQVIKPSSPSFSLPR
(Pan et al. Hippler 2011)Purified Flagella GTQGPPPGSYELPGALGPQVIKPSSPSFSLPR
(Pan et al. Hippler 2011)Purified Flagella GTQGPPPGSYELPGALGPQVIKPSSPSFSLPR
(Pan et al. Hippler 2011)Purified Flagella GTQGPPPGSYELPGALGPQVIKPSSPSFSLPR
(Pan et al. Hippler 2011)Purified Flagella GTQGPPPGSYELPGALGPQVIKPSSPSFSLPR
(Pan et al. Hippler 2011)Purified Flagella GTQGPPPGSYELPGALGPQVIKPSSPSFSLPR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
© Gregory J. Pazour