The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP69 | "FAP69, Flagellar Associated Protein 69; C1b-135 component of C1b projection on central pair"
Aliases: FAP69; C1b-135; CFAP69
Structure: Central Pair
References: "C1b-135 component of C1b projection on central pair (Mitchell et al. Mitchell 2005)"
CrFP Total Peptides = 20 (16 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 4 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 20 (enriched 1.19 fold by ciliary shortening)
Phytozome (gene name | defline): FAP69 | Flagellar Associated Protein
O. Vallon Gene Name | Defline: FAP69 | C1b-135 component of C1b projection on central pair
O. Vallon Description: Conserved Flagellar Associated Protein
O. Vallon Synonyms: Cre03.g168200.t1.1#g3459.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: CFAP69, NP_001034795.2, uncharacterized protein C7orf63 isoform 1 [Homo sapiens] (Blast E value: 0 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: C7orf63, C7orf63 protein
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 5.88; at 10 min: 10; at 30 min: 8.39; at 60 min: 1.7
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 149.29 FPKM | XAP Mutant: 33.21 FPKM | Fold Change: -2.17
CLIP Library: Cre03.g168200
Phytozome Transcript: Cre03.g168200.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
Cre03.g168200.t1.2--S363(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractLGSPGGGAGIGSIPVSR
Cre03.g168200.t1.2--S448(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractASSPGGASALDEFGEEPDIRPLR
FAP69, Conserved Uncharacterized Flagellar Associated Protein(Pazour unpublished)Purified FlagellaASSPGGASALDEFGEEPDIRPLRASpSPGGASALDEFGEEPDIRPLR
(Pan et al. Hippler 2011)Purified Flagella ASSPGGASALDEFGEEPDIRPLR
(Pan et al. Hippler 2011)Purified Flagella ASSPGGASALDEFGEEPDIRPLR
(Pan et al. Hippler 2011)Purified Flagella ASSPGGASALDEFGEEPDIRPLR
(Pan et al. Hippler 2011)Purified Flagella ASSPGGASALDEFGEEPDIRPLR
(Pan et al. Hippler 2011)Purified Flagella ASSPGGASALDEFGEEPDIRPLR
(Pan et al. Hippler 2011)Purified Flagella ASSPGGASALDEFGEEPDIRPLR
(Pan et al. Hippler 2011)Purified Flagella GAGHDDGSDWQQLPDGASAGSGSVYEAAVSLR
(Pan et al. Hippler 2011)Purified Flagella GAGHDDGSDWQQLPDGASAGSGSVYEAAVSLR
(Pan et al. Hippler 2011)Purified Flagella GAGHDDGSDWQQLPDGASAGSGSVYEAAVSLR
(Pan et al. Hippler 2011)Purified Flagella GAGHDDGSDWQQLPDGASAGSGSVYEAAVSLR
(Pan et al. Hippler 2011)Purified Flagella GAGHDDGSDWQQLPDGASAGSGSVYEAAVSLR
(Pan et al. Hippler 2011)Purified Flagella GAGHDDGSDWQQLPDGASAGSGSVYEAAVSLR
(Pan et al. Hippler 2011)Purified Flagella LGSPGGGAGIGSIPVSR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T30ANGEEAAEQQR
T30LESGIEMSESLAAAVR
T30GSVAASGLSGIAEGSAR
T30GGAPDPAEQAR
A32SGVVADVIVALAR
A22VLLLYVSPGEPHPAVR
A20ASSPGGASALDEFGEEPDIRPLR
A20AIQAQFAESGVKPTAPDR
A19AGGPGTLLAFAGSSPGATHLEAALR
A14NSLQSFQFQHGEDD
A14SLPSLEALAAGAGLPVPAGGK
A13GDGASSDAGAGSEPASPSR
A13VLSDLLENPR
A13LGSPGGGAGIGSIPVSR
A13QYLTNQGLLGK
A13LLVDGGMEALLGHLEQGNK
A13WNSDQLATLR
A13LIALFTGPNSADLYDR
A13SALADREPPTSPSAR
A13RWNSDQLATLR