The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP262 | "FAP262, Flagellar Associated Protein 262; Similar to Protein Kinases"
Aliases: FAP262
Structure: (no data)
References: (no data)
CrFP Total Peptides = 2 (0 Axonemal Peptides | 1 M+M Peptides | 1 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 20 (enriched 1 fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 22 | Dhc1b-3 M+M: 17 | Ift139-2 M+M: 25 (Total Unique Peptides)
Picariello Peptides (Picariello et al. Witman 2019) = Wild Type M+M: 35 | Ift140 ΔN-terminal WD repeat M+M: 13 (Total Unique Peptides)
Zhao Central Apparatus Project (Zhao et al. Witman 2019) = Wild Type Axo: 205 | Pf18 Axo: 170 (Total Unique Peptides, summed from two biological replicates for each. Proteins found only in this dataset needed 10 or more peptides to be included)
Phytozome (gene name | defline): FAP262 | 2
Annotation v5.6 Symbol | Defline: FAP262 | Flagellar Associated Protein, protein kinase
Annotation v5.6 Description: Flagellar Associated Protein, similar to protein kinases, found in the flagellar proteome
Annotation v5.6 Synonyms: g3367.t1
Steve King Dynein Anotation: (no data) | (no data)
Yuqing Hou's Human Homologs: CDKL5, NP_003150.1, cyclin-dependent kinase-like 5 [Homo sapiens] (Blast E value: 0.00E+00 | Reprocal Best Match? No)
Albee et al. Dutcher 2013 Human Homolog: CDKL5, cyclin dependent kinase 5 transcript variant
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid): (no data)
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 7.45; at 10 min: 13.28; at 30 min: 4.45; at 60 min: 2.14
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 158.81 FPKM | XAP Mutant: 37.3 FPKM | Fold Change: -2.09
CLIP Library: Cre03.g164250
Phytozome Transcript: Cre03.g164250.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
(Pan et al. Hippler 2011)Purified Flagella AADGMETERPSAGKEAKDEEVEVAAAE
(Pan et al. Hippler 2011)Purified Flagella ASGSGGAGAAEPATPLTPMRPSGTGVSDAGGDEDVVTSR
(Pan et al. Hippler 2011)Purified Flagella ASGSGGAGAAEPATPLTPMRPSGTGVSDAGGDEDVVTSR
(Pan et al. Hippler 2011)Purified Flagella ASGSGGAGAAEPATPLTPMRPSGTGVSDAGGDEDVVTSR
(Pan et al. Hippler 2011)Purified Flagella ASGSGGAGAAEPATPLTPMRPSGTGVSDAGGDEDVVTSR
(Pan et al. Hippler 2011)Purified Flagella ASGSGGAGAAEPATPLTPMRPSGTGVSDAGGDEDVVTSR
(Pan et al. Hippler 2011)Purified Flagella ASGSGGAGAAEPATPLTPMRPSGTGVSDAGGDEDVVTSR
(Pan et al. Hippler 2011)Purified Flagella ASGSGGAGAAEPATPLTPMRPSGTGVSDAGGDEDVVTSR
(Pan et al. Hippler 2011)Purified Flagella ASGSGGAGAAEPATPLTPMRPSGTGVSDAGGDEDVVTSR
(Pan et al. Hippler 2011)Purified Flagella ASGSGGAGAAEPATPLTPMRPSGTGVSDAGGDEDVVTSR
(Pan et al. Hippler 2011)Purified Flagella ATPMSSYFERDETQLTNGQEGETLGDDGVATPR
(Pan et al. Hippler 2011)Purified Flagella DETQLTNGQEGETLGDDGVATPR
(Pan et al. Hippler 2011)Purified Flagella LAWAGSPGGASGPGYAATSGYGGSPR
(Pan et al. Hippler 2011)Purified Flagella LAWAGSPGGASGPGYAATSGYGGSPR
(Pan et al. Hippler 2011)Purified Flagella VLGDAPPPGADGEGSDTATTADQAAVEANMAR
(Pan et al. Hippler 2011)Purified Flagella YLPGRPTSHLTDYVATR
(Pan et al. Hippler 2011)Purified Flagella YLPGRPTSHLTDYVATR
(Pan et al. Hippler 2011)Purified Flagella YLPGRPTSHLTDYVATR
(Pan et al. Hippler 2011)Purified Flagella YLPGRPTSHLTDYVATR
v2: 155077 | v3: 144070 (Boesger et al. Mittag 2009)Purified FlagellaYLPGRPTSHLTDYVATRYLPGRPTSpHLTpDYpVATR
v2: 155077 | v3: 144070 (Boesger et al. Mittag 2009)Purified FlagellaYLPGRPTSHLTDYVATRYLPGRPTpSHLTpDYpVATR
v2: 155077 | v3: 144070 (Boesger et al. Mittag 2009)Purified FlagellaYLPGRPTSHLTDYVATRYLPGRPTSpHLTpDYVATpR
v2: 155077 | v3: 144070 (Boesger et al. Mittag 2009)Purified FlagellaYLPGRPTSHLTDYVATRYLPGRPTSpHLTDYpVATpR
v2: 155077 | v3: 144070 (Boesger et al. Mittag 2009)Purified FlagellaYLPGRPTSHLTDYVATRYLPGRPTpSpHLTDYpVATR
v2: 155077 | v3: 144070 (Boesger et al. Mittag 2009)Purified FlagellaYLPGRPTSHLTDYVATRYLPGRPTpSHLTpDYVATpR
v2: 155077 | v3: 144070 (Boesger et al. Mittag 2009)Purified FlagellaYLPGRPTSHLTDYVATRYLPGRPTpSHLTDYpVATpR
v2: 155077 | v3: 144070 (Boesger et al. Mittag 2009)Purified FlagellaYLPGRPTSHLTDYVATRYLPGRPTpSpHLTDYVATpR
v2: 155077 | v3: 144070 (Boesger et al. Mittag 2009)Purified FlagellaYLPGRPTSHLTDYVATRYLPGRPTpSpHLTpDYVATR
v2: 155077 | v3: 144070 (Boesger et al. Mittag 2009)Purified FlagellaYLPGRPTSHLTDYVATRYLPGRPTSHLTpDYpVATpR
v2: 155077 | v3: 144070 (Boesger et al. Mittag 2009)Purified FlagellaYLPGRPTSHLTDYVATRYpLPGRPTSHLTpDYpVATR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
C13AAAEAAAAAESQAAAAAEAK
B05AAAEAAAEAK
© Gregory J. Pazour