The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP1 | "FAP1, Flagellar Associated Protein 1"
Aliases: FAP1
Structure:
References:
CrFP Total Peptides = 11 (5 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 6 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 2 (enriched 1 fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 0 | Dhc1b-3 M+M: 0 | Ift139-2 M+M: 0 (Total Unique Peptides)
Phytozome (gene name | defline): FAP1 | Flagellar Associated Protein
Annotation v5.6 Symbol | Defline: FAP1 | Flagellar Associated Protein 1
Annotation v5.6 Description: Flagellar Associated Protein, found in the flagellar proteome
Annotation v5.6 Synonyms: g2584.t1#Cre02.g144450.t1.1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: none, , (Blast E value: | Reprocal Best Match? No)
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 7.42; at 10 min: 12.58; at 30 min: 11.95; at 60 min: 3.77
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 435.80 FPKM | XAP Mutant: 47.80 FPKM | Fold Change: -3.19
CLIP Library: Cre02.g144450
Phytozome Transcript: Cre02.g144450.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T16MLGTYVSDQPHADR
T16SRGSFQEGQAMVR
T16QKQPLEFMTQIRPHTETTNQALR
T15NSGFDSNTCPAVLTHSTFK
T15AGLYSYGVPIEEQHPITAR
T15RGMGATLTDGR
A38GSFQEGQAMVR
A37LDCGKDDAFTYNR
A37LYTATQGSDVWAR
A37LGMFIPAGCPGGKPAYHPDVTTGGFGLLPTLPR
A37LTVDASVR
© Gregory J. Pazour