The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): DII7 | "DII7 (FAP120), Inner Arm Dynein interacting protein"
Aliases: DII7; FAP120
Structure: Inner Arm Dynein
References: "Part of IC138 subcomplex (Ikeda et al. Kamiya 2009) and (Bower et al. Porter 2009)(Hom et al. King 2011)"
CrFP Total Peptides = 9 (0 Axonemal Peptides | 0 M+M Peptides | 9 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = (enriched fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 2 | Dhc1b-3 M+M: 1 | Ift139-2 M+M: 2 (Total Unique Peptides)
Phytozome (gene name | defline): DII7 | Flagellar Associated Protein
Annotation v5.6 Symbol | Defline: DII7 | Inner Arm Dynein interacting protein
Annotation v5.6 Description: Part of IC138 subcomplex (PubMed ID:19021242 Ikeda et al. Kamiya 2009) and (PubMed ID:19420135 Bower et al. Porter 2009)(PubMed ID:21953912 Hom et al. King 2011); null-allele mutant was isolated (PMID 29743196)
Annotation v5.6 Synonyms: g2409.t1#FAP120
Steve King Dynein Anotation: DII7 | Inner arm dynein interacting protein
Yuqing Hou's Human Homologs: ANK2, NP_001139.3, ankyrin-2 isoform 1 [Homo sapiens], inner arm dynein interacting protein annotated by Steve King (Blast E value: 0 | Reprocal Best Match? No)
Albee et al. Dutcher 2013 Human Homolog: ANK2, ankyrin-2 isoform 1
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 7.4; at 10 min: 12; at 30 min: 9.96; at 60 min: 2.37
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre02.g116400
Phytozome Transcript: Cre02.g116400.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
C29SKLAAELAALEAEADAK
C29VAEGGPGER
C29GHDQVVGLLLTHNAHTAFKNAYGNTALSLATGAK
C28LAAELAALEAEADAK
C28NAYGNTALSLATGAK
C28EGDYEAVQIALDR
C28LAEEEAKR
C28RVAEGGPGER
C28IKAEEEER
© Gregory J. Pazour