The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP101 | "FAP101, Flagellar Associated Protein 101; C1a-86; C1a projection on central pair"
Aliases: FAP101; C1a-86; PF6-IP1
Structure: Central Pair
References: "C1a-86 , C1a projection on central pair (Wargo et al. Smith 2005)"
CrFP Total Peptides = 10 (6 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 4 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 7 (enriched 0.82 fold by ciliary shortening)
Phytozome (gene name | defline): FAP101 | Flagellar Associated Protein
O. Vallon Gene Name | Defline: FAP101 | Flagellar Associated Protein 101 of central pair projection C1a
O. Vallon Description: Flagellar Associated Protein with weak similarity to a kinase regulatory subunit; also known as C1a-86; form the C1a projection, with PF6, C1a-34, C1a-32, C1a-18, and calmodulin; may play a role in modulating both inner and outer dynein arm activity
O. Vallon Synonyms: C1a-86#g2307.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: TCTE1, NP_872345.2, T-complex-associated testis-expressed protein 1 [Homo sapiens]; C1a-86 (Cr) (Blast E value: 0 | Reprocal Best Match? No)
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 2.4; at 10 min: 6.19; at 30 min: 6.69; at 60 min: 2.74
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 56.32 FPKM | XAP Mutant: 22.71 FPKM | Fold Change: -1.31
CLIP Library: Cre02.g112100
Phytozome Transcript: Cre02.g112100.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
Cre02.g112100.t1.1--S112 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractVAPSGPEADALLGATGVSAFSNHLGSPRVAPSGPEADALLGATGVSAFSNHLGpSPR
Cre02.g112100.t1.1--S112(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractVAPSGPEADALLGATGVSAFSNHLGSPR
(Pan et al. Hippler 2011)Purified Flagella VAPSGPEADALLGATGVSAFSNHLGSPR
(Pan et al. Hippler 2011)Purified Flagella VAPSGPEADALLGATGVSAFSNHLGSPR
(Pan et al. Hippler 2011)Purified Flagella VAPSGPEADALLGATGVSAFSNHLGSPR
(Pan et al. Hippler 2011)Purified Flagella VAPSGPEADALLGATGVSAFSNHLGSPR
(Pan et al. Hippler 2011)Purified Flagella VAPSGPEADALLGATGVSAFSNHLGSPR
(Pan et al. Hippler 2011)Purified Flagella VAPSGPEADALLGATGVSAFSNHLGSPR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T05VLTESQFHGLVEGAAAALTQGELR
T05LGVTYEELMHFLSSDDQVVR
T05LAPDPATAAAVAPAGVAGPR
T05QSLMEAAAAPGSGWDVSEGDLEAVLSPAVLR
A19LLGTATAGR
A18IRDKTEIVINTLLDSK
A18LADWLAGHPTLTSLDLTNNLIADR
A18EALTEVTAEWGFTPDALEEVLSHER
A18LMQAGPWQR
A18SSPAEIVR