The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP328 | "FAP328, Flagellar Associated Protein 328"
Aliases: FAP328; CSE15
Structure: (no data)
References: (no data)
CrFP Total Peptides = 5 (0 Axonemal Peptides | 0 M+M Peptides | 5 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = (no data) (enriched (no data) fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: (no data) | Dhc1b-3 M+M: (no data) | Ift139-2 M+M: (no data) (Total Unique Peptides)
Picariello Peptides (Picariello et al. Witman 2019) = Wild Type M+M: (no data) | Ift140 ΔN-terminal WD repeat M+M: (no data) (Total Unique Peptides)
Phytozome (gene name | defline): |
Annotation v5.6 Symbol | Defline: FAP328 | Flagellar Associated Protein 328
Annotation v5.6 Description: Predicted protein of CSE family: belongs to family E of Chlamydomonadale-specific proteins, found in clusters, mostly on chromosome 8 and carrying two Ser/Pro-rich domains; function unknown but members have been found in the flagellar proteome
Annotation v5.6 Synonyms: g2083.t1
Steve King Dynein Anotation: (no data) | (no data)
Yuqing Hou's Human Homologs: none, (no data), (no data) (Blast E value: (no data) | Reprocal Best Match? (no data))
Albee et al. Dutcher 2013 Human Homolog: (no data), (no data)
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid): (no data)
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: (no data); at 10 min: (no data); at 30 min: (no data); at 60 min: (no data)
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 46.42 FPKM | XAP Mutant: 22.13 FPKM | Fold Change: -1.07
CLIP Library: Cre02.g102050
Phytozome Transcript: Cre02.g102050.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
C22WMGAPSTGQVTGNVLGK
C22KSGINLPVPAGGSQAK
C22AVVWRDDSDYTSLLTPGSPLYLIDPAKPACPAK
C22AGTNNVLTLPIFFKEPTQVSK
C22CQSVLVVR
© Gregory J. Pazour