The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP328 | "FAP328, Flagellar Associated Protein 328"
Aliases: FAP328; CSE15
Structure:
References:
CrFP Total Peptides = 5 (0 Axonemal Peptides | 0 M+M Peptides | 5 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = (enriched fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: | Dhc1b-3 M+M: | Ift139-2 M+M: (Total Unique Peptides)
Phytozome (gene name | defline): |
Annotation v5.6 Symbol | Defline: FAP328 | Flagellar Associated Protein 328
Annotation v5.6 Description: Predicted protein of CSE family: belongs to family E of Chlamydomonadale-specific proteins, found in clusters, mostly on chromosome 8 and carrying two Ser/Pro-rich domains; function unknown but members have been found in the flagellar proteome
Annotation v5.6 Synonyms: g2083.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: none, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: ; at 10 min: ; at 30 min: ; at 60 min:
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 46.42 FPKM | XAP Mutant: 22.13 FPKM | Fold Change: -1.07
CLIP Library: Cre02.g102050
Phytozome Transcript: Cre02.g102050.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
C22WMGAPSTGQVTGNVLGK
C22KSGINLPVPAGGSQAK
C22AVVWRDDSDYTSLLTPGSPLYLIDPAKPACPAK
C22AGTNNVLTLPIFFKEPTQVSK
C22CQSVLVVR
© Gregory J. Pazour