The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP143 | "FAP143, Flagellar Associated Protein 143"
Aliases: FAP143
Structure:
References:
CrFP Total Peptides = 9 (5 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 4 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = (enriched fold by ciliary shortening)
Phytozome (gene name | defline): FAP143 | Flagellar Associated Protein
Annotation v5.6 Symbol | Defline: FAP143 | Flagellar Associated Protein 143
Annotation v5.6 Description: NULL
Annotation v5.6 Synonyms: Cre11.g474550.t1.1#g1922.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: ARHGEF12, NP_001185594.1, rho guanine nucleotide exchange factor 12 isoform 2 [Homo sapiens] (Blast E value: 0 | Reprocal Best Match? No)
Albee et al. Dutcher 2013 Human Homolog: ,
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 7.79; at 10 min: 13.46; at 30 min: 8.31; at 60 min: 1.97
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 160.72 FPKM | XAP Mutant: 37.3 FPKM | Fold Change: -2.11
CLIP Library: Cre02.g095149
Phytozome Transcript: Cre02.g095149.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
Cre02.g095149.t1.1--S54 (Werth et al. Hicks 2018)Wild Type Whole Cell ExtractNLAASQALKDTSDGTSPTRNLAASQALKDTSDGTpSPTR
Cre02.g095149.t1.1--S54(Werth et al. Hicks 2018) AZD-insensitive Whole Cell ExtractNLAASQALKDTSDGTSPTR
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T13NLAASQALKDTSDGTSPTR
T13STNFSKPMSDYSK
T12SLGDALTATHPR
T12VIEHVQAQTHAADWQSTVQATYRPPSDATR
A34DPTFLAETQMMK
A34DTTMLPNPDVPVTIYTEAVANK
A34NAAAYVNTSK
A34ELKELTGVTR
A34DAADRLMGETAR
© Gregory J. Pazour