The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): RIB72 | "RIB72, Protofilament ribbon protein of flagellar microtubules 72"
Aliases: RIB72
Structure: Axoneme
References: (Ikeda et al. Linck 2003); microtubule inner proteins in the ciliary doublet microtubules (Stoddard et al. Nicastro 2018)
CrFP Total Peptides = 40 (23 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 17 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 22 (enriched 1 fold by ciliary shortening)
Jordan Peptides (Jordan et al. Pigino 2018) = Wild Type M+M: 10 | Dhc1b-3 M+M: 14 | Ift139-2 M+M: 13 (Total Unique Peptides)
Phytozome (gene name | defline): RIB72 | Protofilament ribbon protein of flagellar microtubules
Annotation v5.6 Symbol | Defline: RIB72 | Protofilament ribbon protein of flagellar microtubules
Annotation v5.6 Description: NULL
Annotation v5.6 Synonyms: Cre02.g091700.t1.1#g1718.t1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: EFHC1, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: EFHC1, EF-hand domain-containing protein 1 isoform 1
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 8.83; at 10 min: 14.75; at 30 min: 9.47; at 60 min: 2.62
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 3763.86 FPKM | XAP Mutant: 579.27 FPKM | Fold Change: -2.7
CLIP Library: Cre02.g091700
Phytozome Transcript: Cre02.g091700.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T15NFYLVDADSFTR
T15LPGYTVCLPQSLSDK
T04SGSGALTGDDLEAGLQSAGLK
T04SSVIAADKSGSGALTGDDLEAGLQSAGLK
T04AQVSGKEDAVR
T03EQGGPLPYPGDPVDVYR
T03FYGYFKESVVESNMENHR
T03MVDTDTHKHSATDLAR
T03LPGYTVCLPQSLSDKGFK
T03SLKAQVSGKEDAVR
T03VTRDDGSFFNPGDFSVGDTVSIYGR
T03QDNSGIPQGVFIK
T03TNTTLNPK
T03SSVIAADK
T03QWYKDNLGYTDEEMSPVDVKEPILPKPR
T03HQAISLK
T03HSATDLAR
A21KVILYYYLEDDSMHVAEPR
A21VILYYYLEDDSMHVAEPR
A21DNLGYTDEEMSPVDVK
A21IAQATDGALASGAMGTGVLPASMMQDTATK
A21GKEQGGPLPYPGDPVDVYR
A21ESVVESNMENHR
A21LGLFINVLGRDFYLHDADTFTK
A21DFYLHDADTFTK
A21LGLFINVLGR
A21FWCVWDER
A21QFLENNKK
A21QDNSGIPQGVFIKR
A21KDQCYNAGDFR
A21DQCYNAGDFR
A21LGKPSHLLDGDR
A21DPFPVFLK
A21LPQWVENDR
A21MVDTDTHK
A21EDALAQVK
A21NFYLVDADSFTREFMAAR
A21TTMYGDR
A21LPQWVENDRK
A01EDSPGSTTR
© Gregory J. Pazour