The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): FAP87 | "FAP87, Ankyrin Repeat Flagellar Associated Protein 87"
Aliases: FAP87; ANK2
Structure:
References:
CrFP Total Peptides = 13 (0 Axonemal Peptides | 12 M+M Peptides | 1 KCl Peptides | 0 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 5 (enriched 1.44 fold by ciliary shortening)
Phytozome (gene name | defline): FAP87 | Flagellar Associated Protein with ankyrin repeats
Annotation v5.6 Symbol | Defline: FAP87 | Flagellar Associated Protein 87
Annotation v5.6 Description: Flagellar protein with ankyrin repeats; found in the flagellar proteome [PMID: 15998802]
Annotation v5.6 Synonyms: g1156.t1#ANK2
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: ANK2, NP_001120965.1, ankyrin-2 isoform 3 [Homo sapiens], ANK2 (Chlamy) (Blast E value: 0 | Reprocal Best Match? Yes)
Albee et al. Dutcher 2013 Human Homolog: ANK3, ankyrin 3, node of Ranvier (ankyrin G), isoform CRA_b
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid): N-Myristoylation: MGXXXS/T
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 5.42; at 10 min: 16.54; at 30 min: 10.51; at 60 min: 2.34
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre01.g052150
Phytozome Transcript: Cre01.g052150.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
C14ALLAEGGSQGIKDASGSTALFAAADAGHPEVLK
B29ELDDAAAAQR
B26VLLAAGAAR
B26DGNTPLAVAAQSGHEEVVR
B11NLEATAHAER
B10ATAQEEEAAAAER
B10EDAEAAAQR
B10SRLDDAASAER
B10NKLDEVAAVER
B10KRLDADAELAR
B10QLEETMATFAK
B10QRLDEEAAAK
B10LDEEAAAK
© Gregory J. Pazour