The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): DAAK1 | "DAAK1, ODA5-Associated Adenylate Kinase"
Aliases: DAAK1; FAK1
Structure: Outer Arm Dynein
References: (Wirschell et al. Witman 2004)
CrFP Total Peptides = 33 (4 Axonemal Peptides | 5 M+M Peptides | 18 KCl Peptides | 6 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = 21 (enriched 0.78 fold by ciliary shortening)
Phytozome (gene name | defline): DAAK1 | ODA5-associated flagellar adenylate kinase
O. Vallon Gene Name | Defline: DAAK1 | ODA5-Associated Adenylate Kinase
O. Vallon Description: 3 nearly identical repeats of an adenylate kinase domain; corresponds approximately to GI:46518741; reduced in the flagellum of the outer dynein arm oda5 mutant [PMID: 156435]. Previously annotated as two distinct FAKs, but no current evidence for this
O. Vallon Synonyms: FAK1#g676.t1#FAK2
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: AK5, , (Blast E value: | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: AK5, adenylate kinase isoenzyme 5 isoform 2
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid): N-Myristoylation: MGXXXS/T
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 1.94; at 10 min: 3.17; at 30 min: 4.42; at 60 min: 2.68
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: FPKM | XAP Mutant: FPKM | Fold Change:
CLIP Library: Cre01.g029750
Phytozome Transcript: Cre01.g029750.t1.1
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T28ALDQAAQFESSIMPCK
T28DMIASGGKFFLIDGFPR
T28AALDAMGAPK
T28TVLFFDCPEEEMEKR
T28VALEGLSVVK
T27ALDQAEQFESSIMPCK
C14GTQCDQIKEEYECVHLSAGDLLR
C13LVPVAVTLNLLK
C12CHVISAVAAPDDVYGKVK
C12VVLEGLHAPK
C12SDDNADTIR
C12KSEDIALPPVPGSLPADAQIVFVLGGPGSGK
C12TFLDQSLPVKDHYLAQGK
C12VALEGLSVVKK
C12TEQPSKPEPAVPK
C12KSEEIALPSVPGSLPADAQIVFVLGGPGSGK
C11CHVISAVAAPDDVYGK
C11VKVVLEGLHAPK
C11ADYECVHLSAGDLLR
C11FHTFLDQSLPVKDHYLTQGK
C11FHTFLEQSLPVKDHYLAQGK
C11VKAALDAMGAPK
C11RGETSGRSDDNADTIR
C11ADYDCVHLSAGDLLR
B10FFLIDGFPR
B09DMIASGGK
B08CHVISAVPPPKEVYGK
B08GETSGRSDDNADTIR
B07RDMIASGGK
A11LVPVAVTLNLLKR
A11ALDQAAQFENSIMPCK
A11TFLDQSLPVKDHYLTQGK
A11SDDNADTIRK