The Chlamydomonas Flagellar Proteome Project
ChlamyFPv5 (gene name | annotation): RSP10 | "RSP10, Radial Spoke Protein 10"
Aliases: RSP10
Structure: Radial Spoke
References: (Yang et al. Witman 2006)
CrFP Total Peptides = 6 (3 Axonemal Peptides | 0 M+M Peptides | 0 KCl Peptides | 3 Tergitol Peptides)
Wang Peptides (Wang et al. Pan 2017) = (enriched fold by ciliary shortening)
Phytozome (gene name | defline): RSP10 | Radial spoke protein 10
O. Vallon Gene Name | Defline: RSP10 | Radial spoke protein 10
O. Vallon Description: A subunit in the radial spoke head with multiple MORN motifs [PMID: 16507594; GI:83284715]
O. Vallon Synonyms: g131.t1#Cre01.g005450.t1.1
Steve King Dynein Anotation: |
Yuqing Hou's Human Homologs: RSPH1, XP_011528088, radial spoke head 1 homolog isoform X1 [Homo sapiens] (Blast E value: 6.00E-25 | Reprocal Best Match? )
Albee et al. Dutcher 2013 Human Homolog: RSPH1, radial spoke head 1 homolog
Lipid Modifications (N-Myristoylation: MGXXXS/T, S-Geranylgeranylation: CAAX , S-Geranylgeranylation: CC/CXC, S-Farnesylation: CAAX predicted by GPS-Lipid):
Fold Upregulated Post Deflagellation (Albee et al. Dutcher 2013) at 3 min: 3.9; at 10 min: 7.56; at 30 min: 9.8; at 60 min: 4.75
Importance of XAP5 for expression (Li et al. Hu 2018) Wild Type: 215.58 FPKM | XAP Mutant: 36.71 FPKM | Fold Change: -2.55
CLIP Library: Cre01.g005450
Phytozome Transcript: Cre01.g005450.t1.2
PhosphoPeptides
Protein Reference Source Peptide pLOGO
ChlamyFP Peptides
Fraction Sequence
(click on peptide to see other models containing this peptide)
T15GTYTWGVSGAVYTGDYVNGKK
T15WVYADGSMFMGK
T15MVYPDK
A38FGGAAADSKPTAGSYFYSSSSLVQEGHFAK
A36GPCCQLVGDWADGGFTYGR
A36DGSWVGHRDPAVGK